(data stored in ACNUC1104 zone)

EMBL: CP000959.PE123

CP000959.PE123       Location/Qualifiers
FT   CDS_pept        144804..145382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3309"
FT                   /product="acyltransferase-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1811 acyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92464"
FT                   /db_xref="GOA:B1K999"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1K999"
FT                   /protein_id="ACA92464.1"
FT                   /translation="MEWHCCEFEHLSAVDLYAILRARNAVLVVEDAHTHLDIDGKDAGA
FT                   LHVYASVRDGDTTEVAAYARILPGDDIDPDVVIDKVLTSESCRDDDTLERLIERALTAA
FT                   QAAWPDTAVRTHVPAPRQAFYKQFGFRKAYGPYLEQGAPFVGLVRSADRAAGALRQLLS
FT                   RAVSVSRNDDARADGRAHPRLPADTGANR"
     atggaatggc attgttgtga attcgaacat ctgagcgccg tcgatctcta tgcaatcctg        60
     cgcgcgcgca acgccgtgct ggtggtcgag gacgcgcaca cgcatctcga catcgacggc       120
     aaggacgcgg gcgcgctgca cgtctacgcg agcgtgcgcg acggcgacac gacggaagtc       180
     gccgcctacg cgcgcatcct gcccggcgac gacatcgatc cggacgtcgt gatcgacaag       240
     gtgctgacga gcgaaagctg ccgagacgac gacacgctcg aacgcctgat cgagcgcgcg       300
     ctcaccgccg cgcaggccgc gtggccggac accgcggtgc gcacgcacgt gcctgcgccg       360
     cgtcaggcgt tctacaaaca gttcggattc cgcaaggcct acggcccgta tctcgaacag       420
     ggcgcgccgt tcgtgggcct ggtccggtcg gccgaccgcg cggccggcgc gctgcgtcag       480
     ctgctgtcgc gcgccgtttc ggtctcgcgc aacgacgacg cacgcgccga cggccgcgct       540
     cacccccgac tacctgccga taccggagcg aaccgatga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page