(data stored in ACNUC1104 zone)

EMBL: CP000959.PE130

CP000959.PE130       Location/Qualifiers
FT   CDS_pept        complement(154975..156228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3316"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bvi:Bcep1808_4768 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92471"
FT                   /db_xref="GOA:B1K9A6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9A6"
FT                   /protein_id="ACA92471.1"
FT                   /translation="MTAVRKNFALLFALQISTYVVPLVTLPLLTRVLGPQEYGRLSFVL
FT                   AVTTYFINLANYSFDLTATPRVALANDRMERSRIFWTTVCAQWAITVAGFGLLVALTML
FT                   IPHFAAERRALLIGFGMAIGAALTPGWYFQGIQKLSVYSVTVVVYRVLSVAAIFLWVRT
FT                   EDDLLHAVAINTAVPLLCGITLLAYLFFHREVERVQVRLSDVVEALKGGFQVFLASTSI
FT                   SFYASTNTVLLSMVSGNVAAGYFAAGDKLIRAAVGLLQPLRAATYPHVTYLMHHARDEA
FT                   FAFLRKLIVMQGALVLAMSATIYACAPLAVRILYGSSFAPTIGVLHCLALVPFMACMTD
FT                   LFGVQTMLPLGMKRAFSVILISSGALNVTLLPPLAMLFAERGAAIAVLIAETAVAVALA
FT                   YVLRRERVGVLDLSARSG"
     atgaccgccg ttcgaaaaaa ttttgcgttg ttgtttgcgc tgcagatctc gacgtacgtc        60
     gtgccgctcg tcacgctgcc gctcctgacg cgcgtgctcg gcccccaaga gtacggccgg       120
     ctatcgttcg tgcttgcggt gacgacgtat ttcatcaatc tcgcgaacta tagtttcgac       180
     ctgacggcaa cgccgcgtgt cgccctcgca aacgacagga tggagcggtc gcgcattttc       240
     tggacgacgg tttgcgccca atgggcgatc accgtcgccg gcttcgggtt gctcgtcgcg       300
     ctgaccatgc tcattcctca ttttgccgcg gagcgcagag cgctgctgat cggtttcggg       360
     atggcgatcg gtgccgcgct gacgccgggc tggtattttc agggtattca gaagctgagt       420
     gtctatagcg tgacggtggt ggtgtaccgg gtactcagtg tcgctgccat cttcctgtgg       480
     gtgcgcacgg aggacgacct cctgcatgca gtcgcgatca atacggccgt gccattgctg       540
     tgcgggatca cgctgctggc gtacctgttc tttcatcgcg aggtcgagcg cgttcaggtg       600
     cgactttcgg acgtcgtcga agcgttgaaa ggcggctttc aggtgttcct cgcctcgacg       660
     tcgatctcgt tttacgcgtc gaccaatacc gtcctgctga gcatggtttc cggtaacgtc       720
     gccgcaggct attttgcggc cggtgacaaa ctcatccgtg ccgcggtcgg cttgttgcaa       780
     ccgctcaggg cggcaaccta tccgcacgtg acctacctga tgcatcacgc gcgcgacgaa       840
     gcattcgcat tcctgcgcaa gctgatcgtc atgcaaggcg cgctggtgct ggccatgtcg       900
     gcgacgatct atgcatgcgc gccgctggcg gtccgtatcc tgtacggcag ctcgtttgcg       960
     ccgacgatcg gcgtgctgca ttgcctggcg ctggtgccgt tcatggcatg catgaccgac      1020
     ctgttcggcg ttcaaacgat gttgccgctc gggatgaagc gggcgttcag cgtcatcctg      1080
     atctcgtcgg gcgcgttgaa cgtgacgttg cttcctccgc tcgcgatgct gtttgccgaa      1140
     cgtggcgcgg cgatcgcggt gctgatcgcc gaaacggccg tcgccgtcgc gcttgcatac      1200
     gtccttcgcc gtgaacgcgt cggcgtgctc gatctgtcgg cgcgttccgg ttga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page