(data stored in ACNUC1104 zone)

EMBL: CP000959.PE135

CP000959.PE135       Location/Qualifiers
FT   CDS_pept        164630..166831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3321"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bur:Bcep18194_B1822 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92476"
FT                   /db_xref="GOA:B1K9B1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B1"
FT                   /protein_id="ACA92476.1"
FT                   /translation="MRDKLWPAVVLAATLCTTAYAGDADFNAQGDATDAFASAAAQRRA
FT                   DLLVRKMTLDEKLQFIHSQYEMSKVPGGGAGYIQGVPRLGIPDLNMVDSATGSGSTSQA
FT                   STTFPATIAVAASWDRRLSYDYGKQVAIQLRAQGFGMGLAGGTNLAREPRGGRLFEYLG
FT                   EDPLLAGDLLAERTLATQRQKVIATIKHYAGNEQEHGRMGGNTQIDERTLRELYLLPFE
FT                   IAAKRGRPGSVMCSYNRLNGTYACENPHLLNDVLKNEWGFQGQVQSDWGATHSTAAAIN
FT                   AGLDEEEDVGPSVYLTPAAVKQAIANGSVSTARLDDMVRRKLAVMIRVGVMDDPAQGGG
FT                   TIDFAAGNRFAQAASEQSIVLLKNDGNQLPLVASALSRIAVIGGHADAAVLSGGGSGNT
FT                   RDPVSGSFAGCGGLTFGSSTGCSWWRNPWLKVDVPIVAAIRALAPAAQVTYAGNSDQQS
FT                   PFRAYTQQEIDQAAALAGRSDVAIVVVAQPAGEDFGDLQSLSLANPSNQDALVEAVARA
FT                   NPHTVVVVQSGNPVLMPWKDNVSAIVEAWYPGEAGGKAIANVLFGAVNPSGKLPVTFPA
FT                   RDQDSPTWGQNGAFDHDPVYAEKLDMGYRWYDARNIKPMFEFGYGLSYTHFAYSGLSVS
FT                   KQWDGSLSVAFTVRNDGRVAGAETPQVYLGVPYKDEPPKRLVGWEKIRLNPGEARRVRV
FT                   TVSPRMQSVWDTSRNGWRVVSGGTVYVGASSRDIRLQGH"
     atgcgggaca aactctggcc ggccgtcgtg ctggcagcga ccctctgcac cactgcctac        60
     gccggcgacg ccgatttcaa tgcgcagggc gacgcgaccg acgcgttcgc atcggccgcc       120
     gcgcaacggc gcgccgacct gctcgtgcgc aagatgacgc tcgacgagaa acttcaattc       180
     attcattcgc aatacgaaat gtccaaggtg ccgggcggtg gcgccggcta catccagggt       240
     gtgccgcggc tcggcattcc cgatctcaac atggtcgatt cggcgaccgg ctccggcagc       300
     acgtcgcagg ccagcacgac gttcccggcc acgatcgcgg tcgccgcgag ctgggatcgg       360
     cggctgtcgt acgactacgg caagcaggtc gcgatccagt tgcgcgcgca aggattcggg       420
     atgggcctcg ccggcggcac caacctcgcg cgcgagccgc gcggcggccg cctgttcgag       480
     tatctcggcg aggatccgct gctcgccggc gacctgctcg ccgaacgcac gctcgccacg       540
     cagcggcaga aagtcatcgc cacgatcaag cactacgcgg gcaacgagca ggagcacggc       600
     cggatgggcg gcaatacgca gatcgacgaa cgcacgctgc gcgagctgta tctgctgccg       660
     ttcgagatcg ccgcgaaacg cgggcggccc ggtagcgtga tgtgcagcta caaccgcctg       720
     aacggcacct atgcgtgcga gaaccctcat ctgctgaacg acgtgctgaa gaacgagtgg       780
     ggcttccagg gccaggtgca gtccgactgg ggcgccacgc acagcaccgc cgccgcgatc       840
     aatgccgggc tcgacgagga agaagacgtc gggccgagcg tgtacctgac gccggcggcc       900
     gtcaagcagg cgatcgcgaa cggctcggtg tcgaccgcgc gcctcgacga catggtgcgc       960
     cgcaagctcg ccgtgatgat ccgcgtgggc gtgatggacg atccggccca aggcggcggc      1020
     acgatcgatt tcgcggccgg gaaccggttc gcgcaagcgg cttccgagca atcgatcgtt      1080
     ctgctgaaga acgacggcaa ccagttgccg ctcgtcgcgt cggcactgtc gcggatcgcc      1140
     gtgatcggcg gccatgcgga tgcagccgtg ctgtccggcg gcggctcggg taacacgcgc      1200
     gaccccgtat ccggttcgtt cgccggctgc ggaggcctga cgttcggatc gtcgaccggc      1260
     tgcagctggt ggcgcaatcc atggctcaag gtcgacgtgc cgatcgtcgc ggcgatccgc      1320
     gcgctggcgc cggccgcgca ggtcacgtat gcgggcaaca gcgaccagca gtcgccgttc      1380
     cgcgcgtaca cgcagcagga gatcgaccag gccgcggcgc tcgcgggccg ctcggatgtc      1440
     gcgatcgtcg tggtcgcgca gccggccggc gaggatttcg gcgacctgca gagcctgagc      1500
     ctcgcgaacc cgtcgaacca ggatgcgctc gtcgaggccg tcgcgcgcgc gaatccgcat      1560
     acggtcgtgg tcgtccagag cggcaatccg gtgctgatgc cgtggaagga caacgtgtcg      1620
     gccatcgtcg aggcgtggta tccgggcgaa gccggcggca aggcgatcgc gaacgtgctg      1680
     ttcggcgcgg tcaatccgtc gggcaagctg cccgtgactt tcccggcgcg cgatcaggac      1740
     tcgccgacgt gggggcaaaa cggcgcgttc gaccacgacc cggtgtacgc ggaaaagctg      1800
     gacatgggct accgctggta tgacgcgcgc aacatcaagc cgatgttcga gttcggctac      1860
     ggcctgtcgt atacgcactt cgcgtattcg ggtctgtcgg tgtcgaagca atgggacggc      1920
     tcgctgagcg tcgcgttcac cgtacgcaac gacgggcgcg tggccggcgc ggaaacgccg      1980
     caggtctatc tcggcgtgcc gtacaaggac gagccgccga agcggctggt cggctgggaa      2040
     aagatccggc tgaatccggg cgaggcacgg cgggtgcgcg tgaccgtgtc gccgcggatg      2100
     cagagcgtct gggatacgtc gcgcaacggc tggcgggtcg tctcgggcgg gaccgtgtac      2160
     gtcggcgcgt cgtcgcgcga tatccgcttg caaggccatt ga                         2202
//

If you have problems or comments...

PBIL Back to PBIL home page