(data stored in ACNUC1104 zone)

EMBL: CP000959.PE139

CP000959.PE139       Location/Qualifiers
FT   CDS_pept        168875..169462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3325"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: bam:Bamb_3596 protein of
FT                   unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92480"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B5"
FT                   /protein_id="ACA92480.1"
FT                   /translation="MSYSLATSYLRELEIRKSRFIAYAVPVEDRDAAMQVLQRLRDEHP
FT                   AATHVCWALLAGGQSGMSDDGEPSGTAGRPILEVLRHHDLDGVLGAVVRYYGGVKLGAG
FT                   GLVRAYTDAIASALLDAERVERIRHTRLAIEIGYPEEARVRRWIEQAGYALVDSAYGMT
FT                   VKLVIKLPEAAEAAARAELFDLTQGRSGFPDL"
     atgagttatt cgctcgccac ctcctacctc cgcgaactcg aaatccgcaa gagccgtttc        60
     atcgcgtacg cggttcccgt cgaggaccgc gatgccgcga tgcaggtgct gcagcgcctg       120
     cgcgacgagc atccggcggc cacccacgtg tgctgggcgc tgctggcggg cggccagtcg       180
     ggtatgtcgg acgacggcga gccgtcgggc acggcgggcc ggccgatcct cgaagtgctg       240
     cgtcatcacg acctcgacgg cgtgctcggc gcggtcgtgc gttactacgg cggcgtgaaa       300
     ctcggcgcgg gcgggctggt gcgcgcgtac acggatgcga tcgcgtcggc gctgctcgat       360
     gccgagcgcg tcgagcgcat tcggcacacg cggctcgcga tcgagatcgg ctacccggaa       420
     gaggcacgcg tgcgccgctg gatcgaacag gcgggttacg cgctagtgga cagcgcgtac       480
     gggatgacgg taaagctcgt gatcaagctg cccgaagccg ccgaagccgc ggcaagggcc       540
     gaactgttcg acctgacgca aggacgctcc ggcttccccg acctgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page