(data stored in ACNUC1104 zone)

EMBL: CP000959.PE141

CP000959.PE141       Location/Qualifiers
FT   CDS_pept        complement(170579..171973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3327"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bur:Bcep18194_B1835
FT                   OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92482"
FT                   /db_xref="GOA:B1K9B7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B7"
FT                   /protein_id="ACA92482.1"
FT                   /translation="MGNRDTRRPRARPGTVRPLSRWLGATLFACAAAAHAAPQPDGDAP
FT                   PRWQAGADGIGFWPGGDAAGFDASAWMTDAGPARGARNEASGDERQPDTIPLTARKITL
FT                   GQRTGAAARACEAAGDAGADGIGFDDGRTGGGCDPAATHDAPAGDAAARGVVHADRMPY
FT                   ELHPVDPSRLPDLPAAQAPPLLEQLMGDDRNMVGLGWHFVGTTGRSTPVTTRTDALGLN
FT                   SFQNAGSSLSLSNTNTLAFTFTHFVSEHWAAELGAGIPPVLTLRGHGSIALPLDRIFAG
FT                   VHGRFPLIDLGNTQSNPLATTRAWLGSVVFKYYLGERDDRFRPFAGIGVSYTRFTNTNL
FT                   NPVFQRKLASLGGLLAAGADIGSLQSLLLDPALFQRIWDAGGDLLLSGRTNVSAKVKSV
FT                   WEPVFTVGASYQITRRFWLTGMVTYIPLRTRITLDINQPNRLLASNTFDISANPVLATV
FT                   LLNFRF"
     atgggcaatc gcgacacccg ccgcccccgc gcgcggccgg gcaccgtgcg tccgctgtcg        60
     cgctggctcg gcgcgacgct gttcgcatgc gcggccgccg cgcacgccgc gccgcagccc       120
     gacggcgacg ccccaccgcg ctggcaggcc ggcgccgacg ggatcggctt ctggccgggc       180
     ggcgatgcgg ctggcttcga tgcgagcgca tggatgaccg atgcggggcc ggcgcgcggc       240
     gcacgcaacg aagcttcggg cgacgagcgg caacccgata ccattccgct gaccgcccgc       300
     aagatcacgc tcgggcagcg aaccggcgcg gcagcgcgcg cctgcgaggc cgccggcgac       360
     gcgggcgcgg acggcatcgg cttcgacgac ggccgtaccg gcggcggctg cgatccggcc       420
     gccacgcacg atgcaccggc cggcgacgca gcggcgcgcg gcgtcgtcca tgccgaccgg       480
     atgccgtacg aactgcatcc ggtcgatcca tcgcggctgc ccgatctgcc ggccgcgcag       540
     gcgccgccct tgctcgagca actgatgggc gacgaccgca acatggtcgg cctcggctgg       600
     cacttcgtcg ggacgaccgg acgctcgacg cccgtgacga cgcgcaccga cgcgctcggc       660
     ctgaacagtt tccagaacgc gggttcgagc ctgtcactca gcaatacgaa cacgctggcg       720
     ttcacgttca cgcatttcgt ctcggagcac tgggccgccg aactgggcgc cggcattccg       780
     ccggtgctga cgttgcgcgg gcacggcagc atcgcgctgc cgctcgaccg catctttgcc       840
     ggcgtccacg ggcgctttcc gctgatcgat ctcggcaaca cgcaaagcaa tccgctcgcg       900
     accacgcggg cctggctcgg ctcggtcgtg ttcaagtact acctcggcga gcgcgacgac       960
     cgtttccgtc cgttcgcggg catcggcgtc agctacacgc gtttcacgaa cacgaacctg      1020
     aaccccgtgt tccagcgcaa gctcgcatcg ctcggcgggc tgctcgcggc cggcgcggac      1080
     atcggcagcc tgcagtcgct gctgctcgat ccggcgctgt tccagcggat ctgggatgcc      1140
     ggcggcgacc tgctgctgtc ggggcggacc aatgtgtcgg cgaaggtgaa gagcgtctgg      1200
     gagccggtgt tcaccgttgg cgcgagctac cagatcacgc gccggttctg gctcaccggg      1260
     atggtgacct acatcccgct gcgcacccgg atcacgctcg acatcaacca gccgaaccgc      1320
     ctgctggcgt cgaatacgtt cgatatttcg gcgaacccgg tgctggccac cgtcctgctg      1380
     aacttccgct tctga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page