(data stored in ACNUC1104 zone)

EMBL: CP000959.PE143

CP000959.PE143       Location/Qualifiers
FT   CDS_pept        complement(173286..174287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92484"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9B9"
FT                   /protein_id="ACA92484.1"
FT                   /translation="MLGRLFLLNPFSYAFLLRRAVRAIALRTSPARGLRLMRWCSGACL
FT                   RCFPCIRESIERAVAYMLSAHLNDDPRRVREVSAAIVRELFEAEFAGLKLRTHSLASMK
FT                   TMIDGMACEGDDQLRAALARGGPLMLAGLHFGNLMLFVTKLRFMIPDDRKLMVILHRDA
FT                   PGAFFDDALRLVAEYGAGEVEFIDIEERVHLRRLITSLRREAPVFLLFSDLHGKFGKTN
FT                   RCRLGGRWVRMAGGGVKLAVEQGIPLLVAYATGVPFRDRCAVHFTELAASPLAPMLGTD
FT                   DDASPVRATHQRIVDRLEQALVRQPEQWHFWEHFTPYLMPTPLLDAAARRRS"
     atgctcgggc ggctcttcct gctcaatccg ttctcgtatg cgttcctgct acgccgcgcg        60
     gtgcgggcga tcgcgctgcg cacgtcgccc gcgcgtgggc tgcggctgat gcgctggtgc       120
     tcgggcgcgt gcctgcgctg ctttccgtgc atccgcgagt cgatcgagcg cgcggtcgct       180
     tacatgttga gcgcgcacct gaacgacgat ccgcggcgcg tgcgcgaagt gtcggccgcg       240
     atcgtgcgcg agttgttcga ggccgaattc gcggggctca agctgcgcac gcacagcctc       300
     gcatcgatga aaacgatgat cgacgggatg gcatgcgaag gcgacgacca gttgcgcgcg       360
     gcactcgcac gcggcggccc gctgatgctc gccgggctgc acttcggcaa cctgatgctg       420
     ttcgtcacga agctgcgctt catgattccc gacgaccgca agctgatggt gatcctgcac       480
     cgcgacgcgc cgggcgcgtt cttcgacgat gcgctgcggc tcgtcgccga gtacggcgcc       540
     ggcgaagtcg aattcatcga catcgaggag cgcgtgcatc tgcggcggct gatcacgagc       600
     ctgcggcgcg aggcgcccgt gtttctgctg ttctccgact tgcacggcaa gttcggcaag       660
     accaatcgct gtcggctcgg cgggcgctgg gtgcggatgg ccggcggcgg cgtgaagctc       720
     gcggtcgagc agggcattcc gctgctcgtc gcgtatgcga ccggcgtgcc gttccgcgat       780
     cgatgcgcgg tgcatttcac cgagctcgcg gccagcccgc ttgcaccgat gctcggtacc       840
     gacgacgacg cgtcgcccgt gcgcgcgacg caccagcgca tcgtcgaccg tctcgagcag       900
     gcgctcgtgc gccagcccga gcagtggcat ttctgggaac acttcacgcc ttacctgatg       960
     ccgacgccgc tgctcgatgc ggccgcgcgg cgtcgctcct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page