(data stored in ACNUC1104 zone)

EMBL: CP000959.PE153

CP000959.PE153       Location/Qualifiers
FT   CDS_pept        188273..189610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3339"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1853 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92494"
FT                   /db_xref="GOA:B1K9C9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9C9"
FT                   /protein_id="ACA92494.1"
FT                   /translation="MDRANFRVSPTQNKTFRRLPLMPSHADSPAAHHAGSLTIFQGAAL
FT                   YIGAVLGTGVIALPALAADVAGPSSLLAWAALVVLSGPLAATFAALGARYPDAGGVSTY
FT                   ARRAFGPKAAAIVGWCFYFAVPAGAPAAAMFGGAYVAAVTGGGHTTVIVTAAALIATVS
FT                   AANAFGVTVSGRMQLVLSALLVALLLAAVLASAPHARAANLHPFAPHGWLAVGQAAALL
FT                   VWSFAGWEAITHLAAEFRRPAHDMPRSAGIAVVVVGFLYLSVAAASVTVLGPSAGASGA
FT                   PLAELIAGGIGGHAQVLAAAAALLLTLGTMNAYFAGAAKLGAALGRDGALPAWLAQGSQ
FT                   VGGVPRRSLGVIAVLAAVALAATALSDVGPKPLVLVTSGCFVMVYGLGAAAALKLLPRG
FT                   GIAYRCAWISLIAVAGLFVTTGWYFLCPLLLAGGALLYLQITGPRR"
     atggaccgcg cgaacttccg cgtgtcgccc acacaaaaca agaccttccg gagactgccg        60
     ctcatgcctt cgcatgccga ttcgcccgct gcccatcatg cgggttcgct gaccattttc       120
     cagggcgccg cgctctatat cggcgcggtg ctcggcaccg gcgtgatcgc gctgcccgcg       180
     ctcgccgccg acgtcgccgg gccctcctcg ctgctcgcgt gggccgcgct cgtcgtgctg       240
     tccgggccgc tcgcggccac cttcgccgca ctcggcgccc gctatcccga tgcgggcggc       300
     gtgtcgacct acgcgcggcg cgcattcggc ccgaaggccg cggccatcgt cggctggtgc       360
     ttctatttcg cggtgccggc cggcgcgccg gccgccgcga tgttcggcgg cgcctacgtc       420
     gcggccgtca cgggcggcgg acatacgacg gtcatcgtca ccgccgccgc actgatcgcg       480
     accgtatcgg ccgcgaacgc attcggcgtc acagtgtcgg gccgcatgca actcgtgttg       540
     tcggcactgc tcgtcgcgct gctgctcgcc gcggtgcttg cgtccgcgcc gcatgcgcgc       600
     gccgcgaacc tgcatccgtt cgccccgcac ggctggctcg cggtcggcca ggccgccgcg       660
     ctgctcgtgt ggagcttcgc cggctgggaa gccatcacgc acctcgccgc cgaattccgc       720
     cggccggcgc acgacatgcc gcgctcggcc ggcatcgcgg tcgtggtcgt cgggttcctg       780
     tatctgtcgg ttgcggccgc gagcgtgacg gtgctcgggc cttccgcggg cgcatcgggc       840
     gcgccgctcg ccgaactgat cgcgggcggc atcggcggcc atgcgcaggt gctggccgcc       900
     gccgccgcgc tgctgctcac gctcggcacg atgaacgcgt atttcgccgg cgcggccaag       960
     ctcggcgcgg cgctcggacg cgacggcgcg ttgcctgcgt ggctcgctca gggcagccag      1020
     gtcggcggcg tgccgcgtcg cagcctcggc gtgatcgcgg tgctggcggc cgtcgcgctg      1080
     gccgccacgg cgctgtcgga cgtcgggccg aagccgctcg tgctcgtgac gtccggatgt      1140
     ttcgtgatgg tgtacgggct cggcgcggcc gccgcgctga agctgctgcc gcgcggcggc      1200
     atcgcgtacc gctgcgcgtg gatttcgctg attgcggtcg ccgggctgtt cgtgacgacc      1260
     ggctggtatt tcctgtgccc gctgctgctt gcgggcggtg cgctgcttta tctgcagatc      1320
     accggcccgc gtcgatga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page