(data stored in ACNUC1104 zone)

EMBL: CP000959.PE155

CP000959.PE155       Location/Qualifiers
FT   CDS_pept        complement(190081..190455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3341"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   bur:Bcep18194_B1855 protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92496"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D1"
FT                   /protein_id="ACA92496.1"
FT                   /translation="MGDKAIARQQIQVTLGVRFFRTARGHESVREWLHALGQAERRAIG
FT                   EEIKTVQLGWPLGMPLVRKMAKDLWEIRVMVPGRSARVLFTVVGDTMVLLHGFFKQSRG
FT                   TPSDDLDVTVARLKALTRAI"
     atgggcgaca aggcgatcgc gagacagcag attcaggtca cgctcggcgt gcggttcttc        60
     cggacggccc gcggccacga gtcggtgcgc gaatggctcc atgcgctcgg gcaagcggag       120
     cgaagggcga tcggcgaaga gatcaagacc gttcaactcg gctggccgct cggcatgccg       180
     ctggtccgga agatggcgaa ggatctgtgg gagatccgcg tgatggtgcc ggggcgaagc       240
     gcacgcgtgc tgttcacggt cgtcggcgac acgatggtgc tgctgcacgg cttcttcaag       300
     cagtcgcggg gcacgccgtc ggacgatctc gacgtgaccg tcgcgcgcct gaaagcgctg       360
     acgcgcgcca tctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page