(data stored in ACNUC1104 zone)

EMBL: CP000959.PE156

CP000959.PE156       Location/Qualifiers
FT   CDS_pept        complement(190556..191542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3342"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: pca operon transcription factor PcaQ; PFAM:
FT                   regulatory protein LysR; LysR substrate-binding; KEGG:
FT                   bam:Bamb_3582 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92497"
FT                   /db_xref="GOA:B1K9D2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D2"
FT                   /protein_id="ACA92497.1"
FT                   /translation="MNNRIADGRVKFRHLQCFLAVAQLGGVQKAAESLSITQPAVSKTI
FT                   AELEAILGVKLFERGRHGAQPTREAQLFMPHANACVLALRQGVGLLAREGGAAAATLEI
FT                   GMLPTVAASLAPALMKALTARWPRIVVRIATAANAELLERLKAGAIECAIGRLSEPERM
FT                   IGLAFEQLYNEPLVAVVRAGHPLLASAAPAAELARYPVVLPPFGTLIRQSAEQLLGACG
FT                   APPLDSFIEVLSVSVARALALENDAVWFVPLYAAEYDLSAGALARLPLPAAGTDEPVGL
FT                   VLRTDAQPSPVARTLIDAVRDIARSRFGDARPHRAPRAARKPARGKR"
     atgaataacc gtatcgccga cggccgcgtc aaattccggc acctgcaatg ctttctcgcg        60
     gtcgcgcagc tgggcggcgt gcagaaggcg gccgaaagcc tgtcgatcac gcaaccggcc       120
     gtgtcgaaga cgatcgccga gctggaggcg atcctcggcg tgaagctgtt cgagcgcggc       180
     cggcacggcg cgcagcccac ccgcgaagcg caactgttca tgccgcacgc gaatgcgtgc       240
     gtgctggcgc tgcggcaggg cgtcgggctg ctggcgcgcg agggcggggc ggcggccgcg       300
     acactggaaa tcggcatgct gccgaccgtc gcggcctcgc tcgcgccggc cttgatgaag       360
     gcgctgaccg cgcgctggcc gcgcatcgtc gtgcggatcg cgacggccgc gaacgccgag       420
     ttgctcgagc gtctgaaagc cggggcgatc gaatgcgcga tcgggcggct gtcggagccg       480
     gagcggatga tcgggctcgc gttcgagcag ttgtacaacg agccgctcgt cgcggtcgtg       540
     cgcgccgggc atccgctgct tgcgagcgcg gcgccggccg ccgagctggc gcgctatccg       600
     gtcgtgctgc cgccgttcgg cacgctgatc cgccagtccg ccgagcaact gctcggcgca       660
     tgcggcgcgc cgccgctgga ttcgttcatc gaggtgctgt cggtatcggt cgcgcgcgcg       720
     ctggcgctcg agaacgacgc ggtctggttc gtgccgctct atgccgccga atacgacctg       780
     tcggccggtg cgctggcgcg cctgccgctg ccggcggcgg gcaccgacga gccggtcggg       840
     ctcgtgctgc gtaccgatgc gcagccgtcg ccggtcgcgc gcacgctgat cgacgcggtg       900
     cgcgacatcg cgcggtcgcg gttcggcgat gcacgcccgc accgggcgcc acgcgcggcg       960
     cgcaagcctg ctcgcggcaa gcgttga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page