(data stored in ACNUC1104 zone)

EMBL: CP000959.PE157

CP000959.PE157       Location/Qualifiers
FT   CDS_pept        complement(191620..192357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3343"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bam:Bamb_3581 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92498"
FT                   /db_xref="GOA:B1K9D3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D3"
FT                   /protein_id="ACA92498.1"
FT                   /translation="MTETAQLIETLKRQLKAQGMTYRDVARALDVSETSVKRLFASGRF
FT                   TLERVAEIAQLLGYTLAELVQEASASAPRLRVLTEQQEALLVSDEKLLLVAVCAINYWT
FT                   VQDIVAAYRLTQAECVKYLLMLDRMNVIALLPGDRIRVRVARDFDWLPGGPIRRYFHAH
FT                   VLDDFLGSRFDGPGETMTFLQGMLTDAAAAELEQELRRLASKAAALHAESSSAPLGQKH
FT                   GTALLIAKRIWEPTGFHALRRHG"
     atgaccgaga ccgcccaact catcgaaacg ctgaagcgcc agctcaaggc gcagggaatg        60
     acttaccggg acgtcgcgcg cgcgctcgac gtctccgaga cgagcgtgaa gcggctgttc       120
     gcgagcggcc gcttcacgct ggagcgcgtc gcggagatcg cgcagctgct cggctatacg       180
     ctcgccgagc tcgtgcagga agcgtcggca tccgcgccgc gcctgcgcgt gctgaccgag       240
     cagcaggagg cgttgctcgt gtcggacgag aagctgctgc tggtcgccgt ctgcgcgatc       300
     aactactgga ccgtgcagga catcgtggcg gcctatcggc tcacgcaggc cgaatgcgtg       360
     aaatacctgc tgatgctcga ccggatgaac gtgatcgcgc tgctgcccgg cgaccggatt       420
     cgcgtgcggg tcgcgcgcga tttcgactgg ctgccgggcg ggccgatccg ccgttacttt       480
     cacgcgcacg tgctcgacga ctttctcggc agccgcttcg acggccccgg cgagacgatg       540
     acgttcctgc aagggatgct gacggacgcg gccgccgcgg agctcgagca ggaactgcgg       600
     cggctcgcca gcaaggcggc ggcgctgcat gcggagtcgt cgtccgcgcc gctcgggcag       660
     aagcacggca cggccctgct gattgcgaaa cggatctggg agccgacggg attccacgcg       720
     ctgcggcgcc acggatga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page