(data stored in ACNUC1104 zone)

EMBL: CP000959.PE159

CP000959.PE159       Location/Qualifiers
FT   CDS_pept        193329..194036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3345"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, beta
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   bur:Bcep18194_B1859 intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92500"
FT                   /db_xref="GOA:B1K9D5"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9D5"
FT                   /protein_id="ACA92500.1"
FT                   /translation="MDSPTILTPRDWPSHPAYVHPEYRSSVKRGPTRPLIPLKEKLRDQ
FT                   YAPVYGAEDLGALDHDLTKNAVKNGEPLGERMVVTGRVLDEGGKPVRNTLVEVWQANAA
FT                   GRYVHKVDQHDAPLDPNFLGAGRCLTDDEGRYRFLTIKPGAYPWGNHPNAWRPNHIHFS
FT                   LFGDYFGSRLVTQMYFPGDPLLAYDPIFQGTPEAARERLISRFSMDITEEGYALGYEFD
FT                   IVLRGRDATPMER"
     atggattccc ccacgatcct cacgccgcgc gactggccgt cgcatccggc ctatgtccac        60
     cccgagtacc gttcgtccgt gaagcgcggc ccgacccgcc cgctgatccc gctgaaggaa       120
     aaactccgcg accagtacgc gcccgtctac ggcgcggaag atctcggcgc gctcgaccac       180
     gacctgacga agaacgccgt gaagaacggc gagccgctcg gcgagcggat ggtcgtcacc       240
     ggccgcgtgc tcgacgaagg cggcaagccc gtgcgcaaca cgctcgtcga ggtgtggcag       300
     gccaacgcgg ccggccgcta cgtgcacaag gtcgaccagc acgacgcgcc gctcgacccg       360
     aacttcctcg gcgcgggccg ctgcctgacc gacgacgaag gccgctaccg cttcctgacg       420
     atcaagcccg gcgcgtatcc gtggggcaac catccgaacg cgtggcgccc gaatcacatc       480
     cacttctcgc tgttcggcga ttacttcggc tcgcgtctcg tcacgcagat gtacttcccc       540
     ggcgatccgc tgctcgcgta cgacccgatc ttccagggca cgccggaagc cgcgcgcgag       600
     cgcctgatct cgcgcttctc gatggacatc accgaagaag gctatgcgct cggctacgaa       660
     ttcgacatcg tgctgcgcgg ccgcgacgcc accccgatgg agcgctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page