(data stored in ACNUC1104 zone)

EMBL: CP000959.PE165

CP000959.PE165       Location/Qualifiers
FT   CDS_pept        complement(198708..199601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3351"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B1865 ABC
FT                   dipeptide/oligopeptide/nickel family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92506"
FT                   /db_xref="GOA:B1K9E1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9E1"
FT                   /protein_id="ACA92506.1"
FT                   /translation="MNATVQPAAPAASTAIRTPWREFWRKFRKQTVALVAGGFVLALVV
FT                   LAFVGPHIVPFDPENYFDYDALNAGPSAVHWFGVDSLGRDIFSRIVAGTRISLAAGFFS
FT                   VALGAVIGTFFGLLAGYYEGWWDRITMRIADVLFAFPGILLAIGVVAILGNGMVNVICA
FT                   VAIFSIPAFARLVRGNTLMLKHMTYVEAARSIGASDWTIIMRHILPGTVSSVVVYFTMR
FT                   IGTSIITAASLSFLGLGAQPPTPEWGAMLNEARADMVTAPHIAVFPSLAIFLTVLAFNL
FT                   LGDGLRDALDPKLERR"
     atgaacgcga ctgtccagcc cgcggcgccg gccgcatcga ccgcgatccg cacgccgtgg        60
     cgcgaattct ggcgcaagtt ccgcaagcag accgtcgcgc tcgtcgcggg cggcttcgtg       120
     ctcgcgctcg tcgtgctggc gttcgtcggc ccgcacatcg tgccgttcga tccggagaac       180
     tatttcgact acgacgcgct gaacgcgggg ccgtcggccg tgcactggtt cggcgtcgat       240
     tcgctcgggc gcgacatctt cagccggatc gtcgcgggca cccgcatctc gctcgcggcc       300
     ggcttcttct cggtggcgct cggcgcggtg atcggcacgt tcttcgggct gctggccggc       360
     tattacgaag gctggtggga ccgcatcacg atgcgcatcg ccgacgtgct gttcgcgttc       420
     cccggcatcc tcctcgcgat cggcgtggtc gcgatcctcg gcaacgggat ggtcaacgtg       480
     atctgcgcgg tcgcgatctt cagcatcccg gcgttcgcgc ggctcgtgcg cggcaacacg       540
     ctgatgctca agcacatgac ctacgtcgag gccgcgcgca gcatcggcgc gtccgactgg       600
     acgatcatca tgcggcacat cctgccgggc accgtgtcgt cggtcgtcgt ctacttcacg       660
     atgcggatcg gcacgtcgat catcaccgcc gcgagcctgt cgttcctcgg gctcggcgcg       720
     cagccgccga cgccggagtg gggcgcgatg ctcaacgagg cgcgcgcgga catggtgacg       780
     gcgccgcaca tcgcggtgtt cccgagcctc gcgatcttcc tgaccgtgct cgcgttcaac       840
     ctgctcggcg acggcttgcg cgacgcgctc gacccgaagc tggagcgccg ttga             894
//

If you have problems or comments...

PBIL Back to PBIL home page