(data stored in ACNUC1104 zone)

EMBL: CP000959.PE167

CP000959.PE167       Location/Qualifiers
FT   CDS_pept        complement(200597..202159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3353"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bam:Bamb_3571 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92508"
FT                   /db_xref="GOA:B1K9E3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9E3"
FT                   /protein_id="ACA92508.1"
FT                   /translation="MNKPYSFPMFRPRALFAAGAGALALSVAVPAFAQQNVVVAVYSTF
FT                   TTMDPYDANDTVSQAVVKSFYEGLFGFDRNMKLVNVLATSYTASPDAKVYTVKLRQGVK
FT                   FHDGTDFNAAAVKANFDRVTDPANKLKRYGLFRVIEKTEVVDPNTVRFTLREPFSAFIN
FT                   TLAHPSAVMISPAALKKWGRDVSLHPVGTGPFEFVEWKQTDDMKVKKFAGYWKKGYPKV
FT                   DAIDWKPVVDNNTRAALIKTGEADFAFTIPFEQATDLKSNPKVDLIEAPSIIQRYISLN
FT                   TRQKPFDNPKVREALNYAVNKDALAKVVFAGYATPQTGVAPTGVEYATKLGPWPYDPAK
FT                   ARALLKEAGYPNGFESTLWSAYNHTTAQKVIQFVQQQLAQVGVKVQVQALEAGERVARV
FT                   ESAQDAAKAPVRMYYSGWSASTGEANWALSPLLASESAPPKLYNTAYYKNGLVDDDLAQ
FT                   ALSTTDRAKKASLYADAQKQIWADAPWIFLVQEKIVYARSKRLQGMYVMPDGSFNFDEI
FT                   SLK"
     atgaacaagc cgtattcgtt cccgatgttc cgtccgcgcg cgctgttcgc cgcgggggca        60
     ggtgcgctcg cgttgtcggt cgcggtgccc gcgttcgcgc agcagaacgt cgtggtcgcc       120
     gtgtattcga cgtttacgac gatggacccg tacgacgcga acgatacggt gtcgcaggct       180
     gtcgtcaagt cgttctacga aggcctgttc ggtttcgacc ggaacatgaa gctcgtcaac       240
     gtgctggcga ccagctatac ggcgtcgccg gacgcgaagg tgtacacggt caaactgcgc       300
     cagggcgtga aattccacga cggcaccgac ttcaatgccg ccgcggtgaa ggcgaatttc       360
     gaccgcgtga ccgatccggc gaacaagctg aagcggtacg gcctgttccg ggtgatcgag       420
     aagaccgaag tggtcgatcc gaacaccgtg agattcacgt tgcgcgagcc gttctcggcg       480
     ttcatcaaca cactggcgca cccgtccgcg gtgatgattt cgccggccgc gctgaagaag       540
     tgggggcgtg acgtgtcgct gcatccggtt ggcaccggcc cgttcgagtt cgtcgaatgg       600
     aagcagaccg acgacatgaa ggtgaagaaa ttcgccggct actggaagaa ggggtatccg       660
     aaggtcgacg cgatcgactg gaaaccggtg gtcgacaaca acacgcgcgc cgcgctgatc       720
     aagaccggcg aggccgattt cgcgttcacg attccgttcg agcaggcgac cgatctgaag       780
     agcaatccga aggtggactt gatcgaggcg ccgtcgatca tccagcgcta catttcgctg       840
     aacacgcggc aaaagccgtt cgataacccg aaggtgcgcg aagcgctgaa ctacgcggtc       900
     aacaaggatg cgctcgcgaa ggtcgtgttc gccggttacg cgacaccgca gacgggcgtg       960
     gcgccgacgg gcgtcgagta cgcaacgaaa ctcgggccct ggccgtatga cccggcgaag      1020
     gcgcgcgcgt tgctgaagga ggccggctat ccgaacggct tcgaatcgac gctgtggtcc      1080
     gcctacaatc acacgacggc gcagaaggtg atccagttcg tccagcagca gctcgcgcag      1140
     gtcggcgtga aggtgcaggt acaggcgctc gaggccggcg agcgcgtcgc tcgggtggag      1200
     agcgcccagg atgcggcgaa ggcgccggtg cggatgtact acagcggctg gtcggcgtcg      1260
     acgggcgagg cgaactgggc cctgtcgccg ctgcttgcgt cggagtcggc gccgccgaag      1320
     ctgtacaaca cggcgtacta caagaacggt ctggtcgacg acgatctcgc gcaggcactc      1380
     tccacgaccg atcgcgcgaa gaaggccagc ctctacgccg atgcgcagaa gcagatctgg      1440
     gccgacgcgc cgtggatctt cctcgtgcag gagaagatcg tctacgcacg cagcaagcgc      1500
     ctgcagggca tgtacgtgat gccggacggc tcgttcaact tcgacgaaat ctcgctgaaa      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page