(data stored in ACNUC1104 zone)

EMBL: CP000959.PE170

CP000959.PE170       Location/Qualifiers
FT   CDS_pept        complement(205217..206161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3356"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bur:Bcep18194_B1870 transcriptional regulator,
FT                   RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92511"
FT                   /db_xref="GOA:B1K9E6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9E6"
FT                   /protein_id="ACA92511.1"
FT                   /translation="MTPLAPPDVSHDEPAIAERIASAMPLMTPIHRRMGEFVLANPFRA
FT                   ATMRIDELAQAVNASIATANRFAKALGFDGYPAMRAALVRGFEATLGPVERLRSAQEQE
FT                   PGVRGAAWIDAVFDQAVANIENTRAQLDAADVEAAVEAIVGARRVLILGAGSSAFLAGL
FT                   IEHGLSVCHDSVQSLALLGGPSHAARRLYTADSRDLVIALAFPRYVKDTIELARRAAAR
FT                   GARVLGISDGPQSPLAPIASLNLYVKAERRFAATSEAAVLTMIEALIDAVALRTHRSAK
FT                   SAAEMTEFLLPWLVQPQAALPAANPSSPRPKKS"
     atgacgcctc tcgctccgcc cgatgtcagt cacgacgaac ccgcgatcgc cgagcggatc        60
     gcatcggcga tgccgttgat gacgccgatt caccggcgca tgggcgaatt cgtgcttgcg       120
     aacccgtttc gcgcggcgac gatgcggatc gacgagctcg cgcaggcggt gaatgcgtcg       180
     atcgcgaccg cgaaccgctt cgcgaaggcg ctcggtttcg acggctatcc ggcgatgcgc       240
     gcggcgctcg tacgcggctt cgaggccacg ctcgggccgg tcgagcggct gcgttccgcg       300
     caggagcagg agcccggcgt acgcggcgcg gcgtggatcg atgcggtgtt cgaccaggct       360
     gtcgccaaca tcgagaacac gcgtgcgcaa ctggacgcgg ccgatgtcga ggcggcggtc       420
     gaggcgatcg tcggcgcgcg ccgcgtgctg attctcggcg ccgggtcgag cgcgttcctt       480
     gccgggctga tcgagcacgg cctgtccgtc tgccatgaca gcgtgcagtc gctcgcgttg       540
     ctcggcgggc cttcgcatgc ggcccggcgc ctgtacacgg ccgattcgcg cgatctcgtg       600
     atcgcgctcg cgtttccgcg ctacgtgaag gacacgatcg agctggcccg ccgtgcggcg       660
     gcccgcggcg cgcgcgtgct cggcatctcc gacggcccgc aatcgccgct cgcgccgatc       720
     gcgtcgctga acctgtacgt caaggccgaa cggcgtttcg cggccacgtc ggaagccgcg       780
     gtgctgacga tgatcgaggc gctgatcgat gcggtcgcgc tgcgcaccca ccgatccgcg       840
     aaatccgctg ccgagatgac cgaattcctg ctgccgtggc tcgtgcagcc gcaagcggcg       900
     ctgccggccg ccaacccttc ttccccacgt ccgaaaaaat catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page