(data stored in ACNUC1104 zone)

EMBL: CP000959.PE179

CP000959.PE179       Location/Qualifiers
FT   CDS_pept        218319..218597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92520"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F5"
FT                   /protein_id="ACA92520.1"
FT                   /translation="MEHLVRIVNETDRQVLAWLRAQVGDARVERAARQLGHTRKPFPSA
FT                   VCRYLGMSAPATLRPAAARPRAARDFSVGDRYLSLIRQHLATHSVSR"
     atggaacatc tggtccgtat cgtcaacgaa accgatcgcc aagtgctggc gtggcttcga        60
     gcccaggtcg gcgatgcccg cgtcgagcgc gcggcgcgtc agctcgggca tacgcgcaag       120
     cccttcccgt ccgccgtgtg ccggtatctg ggcatgagcg cgccggccac gctgcggccg       180
     gccgccgccc ggccgcgcgc ggcacgcgat ttctcggtcg gcgaccgtta tctgtcgctg       240
     attcgccagc acctcgccac gcactcggtc agccgatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page