(data stored in ACNUC1104 zone)

EMBL: CP000959.PE182

CP000959.PE182       Location/Qualifiers
FT   CDS_pept        complement(219888..220238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3369"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   bur:Bcep18194_B1884 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92523"
FT                   /db_xref="GOA:B1K9F8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9F8"
FT                   /protein_id="ACA92523.1"
FT                   /translation="MNDDFPAGLPGPDQMRAAAESACALLKVMSNPDRLLLLCELSQGE
FT                   RCVSDLEARLDIRQPTLSQQLGVLRDNALVRTRREGKTIRYSLDSPPVVAVMGVLYEQF
FT                   CGATAEEARDAG"
     atgaacgacg attttcccgc cgggttgccc ggtcccgatc agatgcgcgc cgccgccgag        60
     tcggcctgcg cgctcctcaa ggtgatgtcg aatcccgacc ggctgctgtt gctgtgcgaa       120
     ctgtcgcagg gcgagcgctg cgtgagcgat ctcgaggcgc gactggacat ccgtcaaccg       180
     acgctgtcgc agcagctcgg cgtgttgcgg gacaacgcgc tcgtccgcac gcgccgcgaa       240
     ggcaagacca tccgctattc gctcgatagc ccgcccgtag tcgcggtgat gggcgtgctg       300
     tacgaacagt tttgcggcgc gaccgcggag gaggcgcgcg atgcaggttg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page