(data stored in ACNUC1104 zone)

EMBL: CP000959.PE184

CP000959.PE184       Location/Qualifiers
FT   CDS_pept        complement(221779..222987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3371"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; KEGG:
FT                   bur:Bcep18194_B1886 salicylate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92525"
FT                   /db_xref="GOA:B1K9G0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1K9G0"
FT                   /protein_id="ACA92525.1"
FT                   /translation="MDETINKGRHVLVIGGGIGGLAAALALARQGIRVKLLEQAERIGE
FT                   IGAGIQLAANAFNALDALGVGEAARSRAVLTDWLQLMDALDAREVARIDTGAAYRERFG
FT                   NPYAVIHRADIHLSIYEAVEDHPLIEFRTSTQVCGFEQDGHGVTVIDQHGERYRADAVI
FT                   GCDGVKSAIRQALIGDAHRVTGHVVYRAVVDIDDMPKDLQINAPVVWAGPHCHLVHYPL
FT                   RGGRQYNLVVTFHSREQETWGVREGSKEEVLSYFDRIHPLPKQMLDRPTSWKRWATADR
FT                   DPVERWSTGRATVLGDAAHPMTQYIAQGACQALEDAVTLGAAVAQTDGDFEAAFALYER
FT                   VRIPRTARVLYSAREMGRIYHAKGVERQVRNGLWVGRTDAQFYDALDWLHGWRAEDCLK
FT                   TVA"
     atggacgaga caatcaataa aggccggcac gtactcgtga tcggcggcgg tatcggcggg        60
     ctcgcggcgg cgctggcgct tgcgcgtcag ggcattcgcg tgaagctgct cgaacaggcc       120
     gaacggatcg gcgagatcgg tgcgggcatc cagctcgccg cgaacgcgtt caatgcgctc       180
     gatgcgctgg gtgttggcga ggcggcacgc agtcgagccg tattgaccga ctggctgcaa       240
     ctgatggacg cgctcgatgc acgcgaagtc gcacgcatcg atacgggcgc cgcgtatcgc       300
     gaacgcttcg gcaatccgta cgcggtgatc caccgcgcgg acattcacct gtcgatctac       360
     gaggcggtcg aggatcaccc gctgatcgaa ttccggacga gcacgcaggt atgcgggttc       420
     gagcaggacg gccacggcgt gaccgtgatc gaccagcacg gcgaacgcta tcgtgccgac       480
     gcggtgatcg gctgcgacgg cgtgaaatcc gccatccgtc aggcgctgat cggcgatgcg       540
     catcgcgtga cgggccacgt cgtgtatcgc gcggtggtgg acatcgacga catgccgaag       600
     gatctgcaga tcaacgcgcc ggtcgtatgg gccggcccgc attgccatct cgttcactat       660
     ccgctgcgcg gcgggcggca gtacaacctc gtcgtcacgt tccacagccg cgagcaggag       720
     acctggggcg tgcgcgaggg cagcaaggaa gaggtgctgt cgtacttcga ccgcatccat       780
     ccgctgccga aacagatgct cgataggccg acgtcgtgga agcgctgggc gactgccgac       840
     cgcgatccgg tcgagcgctg gagcacgggc cgcgcgacgg tgctcggcga cgccgcgcat       900
     ccgatgacgc aatacatcgc gcagggcgcg tgccaggcgc tcgaggatgc ggtgacgctc       960
     ggcgcggccg ttgcgcagac cgacggcgat ttcgaggccg cgttcgcgct gtacgaacgc      1020
     gtgcggattc cgcgtaccgc gcgcgtgctg tattcggcgc gcgagatggg gcggatctat      1080
     cacgcgaagg gcgtcgagcg gcaggtgcgc aacgggctgt gggtcgggcg caccgatgcg      1140
     cagttctacg acgcgctcga ctggctgcac ggctggcgtg cggaggattg cctgaagacg      1200
     gtcgcatga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page