(data stored in ACNUC1104 zone)

EMBL: CP000959.PE203

CP000959.PE203       Location/Qualifiers
FT   CDS_pept        243437..243934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92544"
FT                   /db_xref="GOA:B1K1W5"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1W5"
FT                   /protein_id="ACA92544.1"
FT                   /translation="MSPSDILLKLLLIGAGATLLMDLWTLFRRQAFGIPSLDYALVGRW
FT                   LGHMMHGRFRHASIVAAAPVPGERALGWVAHYAIGIAFAALPVLIAGPAWIDAPTPLPA
FT                   VVAGLASVVAPFFVMQPAFGFGIAASRTPQPGVARRRSLVTHLSYGVGLYLAAYTLAAL
FT                   SR"
     atgagcccgt ccgacatcct gctcaaactg ctgttgatcg gcgcgggcgc cacgctgttg        60
     atggacctat ggacgctgtt ccggcggcaa gcgttcggga ttccgtcgct cgactacgcg       120
     ctggtcggcc gctggctcgg ccacatgatg cacggccggt tccggcatgc gtcgatcgtc       180
     gccgccgcac ccgtgcccgg cgaacgcgcg ctcggctggg tcgcgcatta cgcgatcggc       240
     atcgcgttcg cggccctacc cgtgctgatt gccggcccgg catggatcga tgcgccgacg       300
     ccgcttcccg cagtcgtcgc cgggctcgcg agcgtggtcg cgccgttctt cgtgatgcag       360
     ccggcgttcg gcttcggcat cgcggcgtcg cgcacgccgc agccgggtgt cgcgcgccgg       420
     cgcagcctcg tcacgcatct gtcgtacggg gtgggactct atctggcggc gtacacgcta       480
     gcggcgctgt cgcgttaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page