(data stored in ACNUC1104 zone)

EMBL: CP000959.PE213

CP000959.PE213       Location/Qualifiers
FT   CDS_pept        254539..255603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3400"
FT                   /product="2-aminoethylphosphonate aminotransferase"
FT                   /note="TIGRFAM: 2-aminoethylphosphonate aminotransferase;
FT                   PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bur:Bcep18194_B1916 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92554"
FT                   /db_xref="GOA:B1K1X5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1X5"
FT                   /protein_id="ACA92554.1"
FT                   /translation="MLLLNPGPVTLSERVRRSLLQPDLCHRESEFFDLQDEARARLVAA
FT                   YELDPAEWAAVLMTGSGTAAVESMIAALVPQEGKLLVIENGVYGERITQIATQYGIAHE
FT                   VLKHEWMQAPDLAQIAAKLDAGGYSYVAVIHHETTTGRLNDLGAIAEVCRARGVKMLVD
FT                   GVSSFGAEAIDFAGGDIDAVAATANKCLHGVPGAAFVIVRRSALAKAASRTYYLDLGRL
FT                   AKLQDQRNTPFTPSVHAYYALVEALREFDEAGGWRARHAHYNALADQAQAGLAARGMPL
FT                   VLPEGASSVVLRAYRLPQGVTYEALHDGLKARGFVIYAGQGGLSKELFRISTMGAIQAA
FT                   DVDRLLEGFTALTR"
     atgctgctgc tgaaccccgg cccggtcacg ctctccgaac gcgtgcgccg cagcctgctg        60
     caacccgatc tgtgccatcg cgaaagcgaa ttcttcgacc tgcaggatga agcgcgtgcg       120
     cgcctcgtcg ccgcgtacga actcgatccg gccgaatggg ccgccgtgct gatgacgggc       180
     tcgggcacgg ccgccgtcga aagcatgatc gcggcgctcg tgccgcagga aggcaagctg       240
     ctcgtgatcg agaacggcgt gtatggcgaa cggatcacgc aaatcgccac gcagtacggc       300
     atcgcgcacg aggtgctcaa gcatgagtgg atgcaggcgc ccgatctcgc gcagatcgct       360
     gcgaagctcg atgcgggtgg gtattcgtat gtcgccgtga tccatcacga aacgacgacg       420
     ggccggctga acgacctcgg cgcgattgca gaagtgtgcc gtgcgcgcgg cgtgaagatg       480
     ctcgtggacg gtgtcagcag cttcggcgcg gaagcgatcg attttgcagg cggcgacatc       540
     gacgcggttg ccgcgaccgc gaacaaatgc ctgcacggcg tgccgggcgc ggcgttcgtg       600
     atcgtgcgcc gcagcgcgct cgcgaaagcg gcgagccgca cgtattacct cgatctcggt       660
     cgtctcgcga agctgcagga tcagcgaaat acgccgttta cgccgtccgt gcatgcgtat       720
     tacgcgctcg tcgaggcgct gcgcgagttc gatgaggcgg gcggttggcg tgcccggcat       780
     gcgcactaca atgcgcttgc cgatcaggcg caggccgggc ttgctgcgcg cgggatgccg       840
     ctggtgctgc cggaaggcgc gtcgtcggtc gtgctgcgtg cgtatcggtt gccgcagggt       900
     gtgacgtatg aagcgctgca cgacggactg aaggcgcgtg gcttcgtgat ttacgcgggg       960
     caaggcgggc tgtcgaagga actgttccgg atctcgacga tgggcgcgat tcaggcagct      1020
     gatgtcgatc ggttgctgga agggtttacg gcgctgacgc ggtaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page