(data stored in ACNUC1104 zone)

EMBL: CP000959.PE216

CP000959.PE216       Location/Qualifiers
FT   CDS_pept        complement(258282..259427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3403"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: aav:Aave_0152
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92557"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1X8"
FT                   /protein_id="ACA92557.1"
FT                   /translation="MKPHYVEPLSGTTYPLDTPRWCSDDRRPLLISPQAGISRDDIDRH
FT                   LRSQWRYRASLPVEIVSPISMGEGCTPLVQKTWGDHRPYFKLEWFSPTSSFKDRGTTVM
FT                   LSMLRQQGIASVLEDSSGNGGASVAAYGAAGAMRVKILAPAYASPAKIAQMRAYGAEVQ
FT                   LVDGPRQACEDEAVRQSASIFYASHNWQPFFLEGTKSIGYEIWEDLHFRAPDNIVMPAG
FT                   VGSNVLGCYLAFSELMRAGQIDKMPRLFVCQPLNCSPIDASFQAGVTTPVAREVRKTVS
FT                   EGTAIAHPLRLAQVVNAVRETGGTTVAVEEAAIVDALTRIARLGLLPELTSATAVAGLD
FT                   RLTQLGAIQAREETVVLLTGTGIKNAEAIADMYSDIPDTLA"
     gtgaaaccgc actatgtcga gccgctcagc ggcactactt atcctctcga cacgccccgg        60
     tggtgctcgg acgaccgcag gccgctcctg atctcgccgc aggccggcat ttcccgggac       120
     gacatcgatc gacaccttcg ctcccaatgg cgctatcgcg catcgctgcc cgtcgagatc       180
     gtctctccca tctccatggg ggaagggtgc acgccgttgg tccagaagac gtggggcgac       240
     caccggccgt atttcaagct ggagtggttc agtcccacga gcagcttcaa ggatcgcggc       300
     acgacggtga tgctctcgat gctgcggcag caaggcatcg cgtccgttct ggaggacagt       360
     tcgggcaacg gcggcgcgtc ggtggcggct tatggtgctg ccggcgccat gcgcgtgaag       420
     attctggcgc ccgcctacgc atcgcccgcg aagattgccc agatgcgagc ctacggggcg       480
     gaggtgcaac tggtcgacgg gcctcgacag gcgtgcgagg acgaggctgt ccggcagtcc       540
     gcgagcatct tctacgccag ccacaattgg cagccctttt tcctcgaagg gaccaagtcg       600
     atcggctacg agatctggga ggacctccac ttccgggcgc cggacaacat cgtcatgccg       660
     gcgggcgtgg gcagcaatgt actcggctgt tatctggcgt tctcggaact gatgcgcgcg       720
     gggcagattg acaaaatgcc caggctcttc gtttgccagc cattgaactg ctcgcctatc       780
     gatgccagct tccaggcggg cgtcacgacg cccgttgcgc gcgaggttcg aaagacggtc       840
     tccgagggga cggccatcgc ccatcctctg cgcctggcgc aagtggtgaa cgcggtcagg       900
     gagacgggcg gcacgacggt ggccgtggag gaagcagcaa tcgtcgacgc gctcacgcgc       960
     attgcgcggc tgggcctttt gccggaactg acttcggcga ccgcggttgc aggattggat      1020
     cggctcacgc aactgggggc gattcaggcg cgagaggaaa cggtcgtcct gctgacgggc      1080
     acgggtatca agaacgccga agccatcgcg gatatgtact cggacattcc cgatacgctt      1140
     gcctaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page