(data stored in ACNUC1104 zone)

EMBL: CP000959.PE217

CP000959.PE217       Location/Qualifiers
FT   CDS_pept        complement(259620..260294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3404"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: dac:Daci_5755 YheO
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92558"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1X9"
FT                   /protein_id="ACA92558.1"
FT                   /translation="MAKLPGMPKQTTGPDMPKKTPDQQLLLGQLKQVAEGLARTFAPFT
FT                   EVVVHDLLDPEHAVLAIHNNLSGREVGQPATELGLARIMDAAYEQIIANYPNQFSDGRQ
FT                   VKSTSIGIKDAKGDYIAALCLNVDLTLFRGFQNMLSSFMAVEGTTPAKESLDPASADLI
FT                   RTRIDEFAARMASTPRSLKPEDRRSLLKELKAAGLLEVRRAMDTIAVYLGVSRATVYSD
FT                   VK"
     atggccaaac tgcccgggat gccaaagcaa accactggac ccgacatgcc gaagaagact        60
     cccgaccagc agctactgct ggggcagctc aaacaggtcg ccgaagggct ggcccggacc       120
     ttcgccccgt ttaccgaggt cgtggtccat gatctcctcg atccggagca cgcggtgctc       180
     gcgatccaca acaatctgtc aggtcgggaa gtcggacagc ctgcgaccga actggggctt       240
     gcgcggatca tggacgccgc ctacgagcag atcatcgcca actatccgaa tcagttctcg       300
     gatggccgcc aggtgaagag cacgtccatc ggcatcaagg acgccaaagg cgactacatc       360
     gccgcgttgt gcctgaacgt cgacctcacg ttgttccggg gatttcagaa catgctgagc       420
     agcttcatgg cggtcgaggg caccacgcct gccaaggaat cgctcgaccc cgccagcgcg       480
     gatctcattc gcacccgtat cgacgaattc gccgcgcgca tggcgtcgac cccgcgctcg       540
     ctcaagccgg aggaccgccg ctcgctcctg aaggagctca aggcggccgg cctgctcgag       600
     gttcgccggg cgatggacac cattgccgtc tacctgggtg tctcgcgcgc cacggtgtac       660
     agcgatgtca aataa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page