(data stored in ACNUC1104 zone)

EMBL: CP000959.PE22

CP000959.PE22        Location/Qualifiers
FT   CDS_pept        complement(25157..25492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92363"
FT                   /db_xref="GOA:B1K883"
FT                   /db_xref="UniProtKB/TrEMBL:B1K883"
FT                   /protein_id="ACA92363.1"
FT                   /translation="MNLLHLVSYFFGGAFLANAVPHLVSGLRGEPFQTPFANPPGRGLS
FT                   SSTVNVLWGVVNLVIAYALMRRAGDFDLKVTADAAAFGLGILALGLFLARHFGALHGGN
FT                   EPDRERP"
     atgaacctcc tgcacctcgt gtcgtacttc ttcggcggcg cgtttctcgc gaacgccgtg        60
     ccgcatctcg tcagcgggct gcgtggcgag ccgttccaga cgccgttcgc gaatccgccc       120
     ggccgcgggt tgtcgtcgtc caccgtgaac gtgctgtggg gcgtcgtgaa tctcgtgatt       180
     gcctatgcgc tcatgcgccg ggccggcgat ttcgacctga aggtcacggc cgacgcggcg       240
     gcgttcggcc tcggcatcct cgcgttgggc ctgttcctcg cgcggcattt cggcgcactg       300
     cacggcggca acgagcccga ccgggagcgg ccgtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page