(data stored in ACNUC1104 zone)

EMBL: CP000959.PE221

CP000959.PE221       Location/Qualifiers
FT   CDS_pept        complement(265415..265705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92562"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Y3"
FT                   /protein_id="ACA92562.1"
FT                   /translation="MQRRQTMIKHFDYTLGSETIALCASFGAGPAFRRVLVSRADSMET
FT                   LVVLDARGLSGLLKVATEEPEGLLDDAIRKVGDEQLVEQAISGRTIVEAAL"
     atgcaacggc ggcagaccat gatcaagcac ttcgactaca cgctcggcag cgagacgatc        60
     gcgctttgtg cgagcttcgg cgcgggcccg gcattccgcc gcgtgctcgt gagccgcgcg       120
     gattcgatgg agacgctcgt ggtgctcgat gcgcgcgggc tgtcaggctt gctgaaggtg       180
     gcgaccgagg aaccggaagg gctgctcgac gacgcgatcc gcaaggtcgg cgacgaacag       240
     ctcgtcgagc aggcgatcag cggccggacg atcgtcgaag ccgctttgtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page