(data stored in ACNUC1104 zone)

EMBL: CP000959.PE222

CP000959.PE222       Location/Qualifiers
FT   CDS_pept        complement(265864..266949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3410"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: bur:Bcep18194_B1931
FT                   transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92563"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Y4"
FT                   /protein_id="ACA92563.1"
FT                   /translation="MVTTKGAPKTPAGSGSARQAPASAPVPAPAQAQSQGQAATNAPAA
FT                   VAPGRLLRVTHDTEYRYAARVESAQHQARLQPLATPRQQVLSFSLDIEPAPESVCTELD
FT                   AFGNARASFALNLPHDTLLVRSRSTVRVTPPAWSLGARGEPPPAIANPDAAQATAWEVV
FT                   RDRLRFRAGQPYDPASEFLFASPHVACDPELAAYAAASFTPQRPLVQAAWDLMRRVHAD
FT                   FAYTPNSTDITTSALDALRLRKGVCQDFAHVMIGALRSLGLAARYVSGYLLTQPPPGQP
FT                   RLIGADASHAWVEVYDPVWPEDGGWLQLDPTNDRAPGDDYVMLSIGRDYADVTPLRGVI
FT                   RGGGADQELKVGVTVEPLDAA"
     atggtgacga cgaaaggcgc gccgaaaacg ccggccggct ccggaagcgc acggcaggcg        60
     ccggcctcgg ctcccgttcc ggctccagcc caggcccaga gccaaggcca ggccgcaacg       120
     aacgcaccgg ccgccgtcgc accgggccgg ttgctgcgcg tcacgcacga caccgaatac       180
     cgttacgcgg cacgcgtcga atccgcgcag caccaggcac gcctgcaacc gctcgcgacg       240
     ccgcgccagc aagtgctgtc gttctcgctc gacatcgagc ccgcaccgga atcggtctgc       300
     accgaactcg acgcgttcgg caatgcacgc gcgtcgttcg cgctgaacct gccgcacgac       360
     acgctgctgg tgcgcagccg cagcaccgtg cgtgtgacgc cgcccgcgtg gtcgctcggt       420
     gcccgcggcg agccgccgcc cgcgatcgcg aacccggacg ccgcgcaggc caccgcgtgg       480
     gaggtcgtgc gcgaccgctt gcggttccgc gcggggcagc cttacgaccc ggcgagcgaa       540
     ttcttgttcg catcgccgca cgtggcgtgc gaccccgaac tcgccgcata cgcggccgcg       600
     agcttcacgc cgcaacggcc gctggtgcag gcggcgtggg atttgatgcg gcgcgtgcat       660
     gccgatttcg cgtacacgcc gaacagcacc gacatcacga cgtcggcgct cgacgcactg       720
     cggctgcgca agggcgtctg ccaggatttc gcgcacgtga tgatcggcgc gctgcgctcg       780
     ctcgggctgg ccgcgcgcta cgtcagcggc tacctgctga cgcagccgcc acccggccag       840
     ccacggctga tcggcgccga tgcgtcgcat gcgtgggtcg aggtgtacga cccggtgtgg       900
     cccgaggatg gcggctggct gcaactcgat ccgaccaacg atcgtgcgcc gggcgacgac       960
     tacgtgatgc tgtcgatcgg gcgtgactac gcggacgtga cgccgctgcg cggcgtgatc      1020
     cgcggcggcg gggcggatca ggagctgaag gtcggcgtga cggtcgagcc gctcgatgcg      1080
     gcttga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page