(data stored in ACNUC1104 zone)

EMBL: CP000959.PE227

CP000959.PE227       Location/Qualifiers
FT   CDS_pept        complement(275296..276711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3415"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: bur:Bcep18194_B1936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92568"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Y9"
FT                   /protein_id="ACA92568.1"
FT                   /translation="MKPFDEMLQSGDMVRAPYARLKQWLDTQNPASLAQKAHDAEGVFR
FT                   KTGITFAVYGDAEAAERLIPFDIVPRIISGAEWSRLSLGIEQRVMALNAFLDDIYHRQE
FT                   IVRAGIVPKHLIAHNEAFIPEMIDFRPPGNVYTHIIGVDIVRTGENAFYVLEDNARTPS
FT                   GVSYMLENRETMMQLFPELFQQVKVRPVETYPQMLRQSLAAVCPPGGNADNPTIAVLTP
FT                   GIHNSAYYEHSFLADQMGVHLVEGSDLQVIDGRVAMRTTEGFQPIDVLYRRVDDAFLDP
FT                   LTFRPDSVLGVAGIMDVYRAGNITIANAPGTGIADDKAIYSYMPEIVEFYTGRKALLEN
FT                   VPTWRCGEADSLKYVLAHLDELVVKEVHGSGGYGMLVGPCASKAELEAFSAKLRARPAN
FT                   YIAQPTLALSTTPILTDAGLAPRHVDLRPFVLVSDRIRITPGGLTRVALQEGSLVVNSS
FT                   QGGGTKDTWVLAD"
     atgaagccat tcgatgaaat gctgcaatcc ggcgacatgg taagggcgcc ttacgcgcgc        60
     ctgaagcaat ggctcgacac gcagaatccc gcgagcctcg cccagaaagc ccacgatgcg       120
     gaaggcgtgt tccgcaagac gggcatcacg ttcgccgtct acggcgacgc ggaggccgcc       180
     gagcggctga ttccgttcga catcgtcccg cgcatcatct cgggggcgga atggagccgg       240
     ctgtcgctcg gcatcgagca gcgcgtgatg gcgctgaacg cgttcctcga cgacatttac       300
     caccgtcagg aaatcgtgcg cgcgggcatc gtgccgaagc acctgatcgc gcacaacgag       360
     gcgttcatcc ccgagatgat cgatttccgg ccgcccggca acgtttacac gcacatcatc       420
     ggcgtcgaca tcgtgcgcac cggcgagaac gcgttctacg tgctggagga caacgcgcgc       480
     acgccgtccg gcgtgtcgta catgctggaa aaccgcgaaa cgatgatgca gctcttcccc       540
     gagctgttcc agcaggtgaa ggtgcgcccg gtcgaaacct atccgcagat gctgcgccag       600
     tcgctcgcgg ccgtgtgccc gccgggcggc aatgccgaca acccgaccat cgcggtgctc       660
     acgcccggca tccacaattc cgcgtactac gaacattcgt tcctcgccga ccagatgggt       720
     gtgcacctcg tcgagggcag cgacctgcag gtgatcgacg ggcgcgtcgc gatgcgcacg       780
     accgaaggct tccagccgat cgacgtgctg taccgccgcg tcgacgacgc gttcctcgat       840
     ccgctgacgt tccgccccga ttcggtgctc ggcgtggccg gcatcatgga cgtgtaccgc       900
     gcgggcaaca tcacgatcgc gaacgcgccc ggcaccggca tcgccgatga caaggcgatc       960
     tactcgtaca tgccggagat cgtcgagttc tacacgggcc gcaaggcgct gctggagaac      1020
     gtgccgacct ggcgctgcgg cgaggccgac agcctgaaat acgtgctcgc gcatctcgac      1080
     gaactggtcg tgaaggaagt gcacggctcg ggtggctacg ggatgctggt cgggccgtgc      1140
     gcgtcgaagg ccgaactcga ggcattttcc gcgaagctgc gcgcgcgtcc cgcgaactac      1200
     atcgcgcagc cgacgctcgc gctgtccacg acgccgatcc tgaccgacgc cggcctcgcg      1260
     ccgcgccacg tcgacctgcg tccgttcgtg ctggtgtcgg accgaatccg catcacgccg      1320
     ggcgggctca cgcgcgtcgc gctgcaggaa gggtcgctcg tcgtcaactc gagccagggc      1380
     ggcggcacca aggacacctg ggtgctggcc gactga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page