(data stored in ACNUC1104 zone)

EMBL: CP000959.PE234

CP000959.PE234       Location/Qualifiers
FT   CDS_pept        286293..286781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92575"
FT                   /db_xref="GOA:B1K1Z6"
FT                   /db_xref="UniProtKB/TrEMBL:B1K1Z6"
FT                   /protein_id="ACA92575.1"
FT                   /translation="MKNAPIIDLSLRAPRDMIAERGNIVGPVLVAWFRLVRPALVGGVW
FT                   ASICIYTYRYLLPFNEAEMPIEQIVFYVTSIALIAGTIVMWLIAGRVVHPFAYRLRVSK
FT                   MLRRSASVKVRSVPPTAFASERRRGARRTTRILVASHDANGSISGIEWIAHAEPQPRE"
     atgaagaacg cgccgattat tgacctttcc ctgcgcgcac cgcgcgacat gatcgccgaa        60
     cgcggcaaca tcgtcgggcc cgtgctcgtc gcgtggttcc gtctcgtgcg gcctgcgctg       120
     gtcgggggcg tatgggcctc gatctgcatc tatacgtacc gttacctgtt gccgttcaac       180
     gaggccgaga tgccgatcga acagatcgtg ttctacgtga ccagcatcgc gctgatcgcc       240
     ggcacgatcg tcatgtggct gatcgcgggg cgcgtcgtgc atccgttcgc ttaccggttg       300
     cgggtgtcga agatgctgcg gcgttcggcc agcgtgaagg tgcgctcggt gccgccgacc       360
     gcgttcgcga gcgagcgccg gcgcggcgcg cgacgcacga cgcgcattct cgtcgcgtcg       420
     cacgatgcga acgggtcgat ttccggcatc gagtggatcg cgcatgccga gccgcaaccg       480
     cgcgaatga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page