(data stored in ACNUC1104 zone)

EMBL: CP000959.PE238

CP000959.PE238       Location/Qualifiers
FT   CDS_pept        complement(291148..292404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3426"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bur:Bcep18194_B1948 allantoate amidohydrolase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92579"
FT                   /db_xref="GOA:B1K200"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B1K200"
FT                   /protein_id="ACA92579.1"
FT                   /translation="MRNDADIASMPRVDGDRLWASLERMAQIGATPKGGVCRLALTDLD
FT                   RESRDLFVQWARDAGCTVRVDRMGNVFARRAGRNPDAAPVMTGSHADSQPTGGRYDGIY
FT                   GVLGGLEVVRALNDAGIETERPVDVVIWTNEEGSRFAPAMVSAGVFSGVYTLEYGLSRS
FT                   DGTGRTIGEELERIGYAGAEPVGGYPVHAAYELHIEQGAILERAGKTIGVVTAGQGQRW
FT                   YEVTLTGVDAHAGTTPMAFRRDALVGAARMISFIEVLGRRYAPDARATVGMIEARPNSR
FT                   NTVPGGCFFTVEFRHPDDAVLDELDAALRAELARLADETGLGARIEQIFTYAPVPFAPR
FT                   CIDTVRDAARSLGLSHMDIVSGAGHDACYVARVAPTGMIFVPCVDGLSHNEAEAITPEW
FT                   ATAGADVLLRAVLQSAQEA"
     atgcgtaacg atgccgatat cgcgagcatg ccgcgcgtcg acggcgaccg cctgtgggca        60
     tcgctcgaac ggatggcgca gatcggcgcg acgccgaagg gcggcgtgtg ccgtctcgcg       120
     ttgaccgatc tcgaccgcga gtcgcgcgac ctgttcgtgc agtgggcgcg tgacgccggc       180
     tgcacggtgc gcgtcgaccg gatgggcaac gtgttcgcgc gccgcgcagg ccgcaatccg       240
     gacgccgcac cggtgatgac gggctcgcat gccgattcgc agccgaccgg cggccgctac       300
     gacggcatct acggcgtgct cggcgggctc gaagtcgtgc gcgcgctgaa cgacgcgggc       360
     atcgagaccg agcgcccggt cgacgtcgtg atctggacca acgaggaagg ctcgcgcttc       420
     gcgccggcga tggtgtcggc cggcgtgttc tcgggcgtct atacgctcga atacgggttg       480
     tcgcgcagcg acggcacggg ccggacgatc ggcgaggagc tcgaacggat cggctacgca       540
     ggcgcggagc cggttggcgg ctatccggtg cacgcggcgt acgaactgca tatcgagcag       600
     ggcgcgattc tggaacgggc cggcaagacg atcggcgtcg tgacggccgg gcaggggcag       660
     cgctggtacg aggtgacgct caccggcgtc gacgcgcatg ccggtacgac gccgatggcg       720
     ttccgtcgcg acgcgctggt tggcgcggca cggatgatct cgttcatcga agtgctcggc       780
     cgccgctacg caccggatgc gcgcgcaacg gtcgggatga tcgaggcgcg gccaaattcg       840
     cgcaacacgg tgccgggcgg ctgcttcttc acggtggaat tccgtcaccc cgacgatgcg       900
     gtcctcgatg aactggacgc cgcgctgcgc gcggaactcg cgcgcctggc cgacgaaacc       960
     ggcctcggcg cgcggatcga gcagatcttc acgtatgcgc cggtgccgtt cgcgccacgc      1020
     tgcatcgaca cggtgcgtga cgcggcgcgc tcgctcgggc tgtcgcacat ggacatcgtg      1080
     tccggcgcgg gccatgacgc gtgctatgtc gcgcgtgtcg cgccgaccgg catgatcttc      1140
     gtgccgtgcg tcgacggcct gagccacaac gaggccgaag cgattacgcc ggaatgggcg      1200
     acggccggcg ccgacgtgct gttgcgcgcg gtgctgcaga gcgcgcagga agcgtaa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page