(data stored in ACNUC1104 zone)

EMBL: CP000959.PE239

CP000959.PE239       Location/Qualifiers
FT   CDS_pept        complement(292397..292921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92580"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:B1K201"
FT                   /protein_id="ACA92580.1"
FT                   /translation="MTEVNPTSAAAPEDSRLGILARRRIEAEIIKPIYEIMKREFGAER
FT                   AQAVIAEAVRGAAVDAGRTFAAQEPDGTSVKSFIALQVLWEKDDALDVEVRRADDAHYD
FT                   YDVHRCSYAEMYHAMGLGEIGHLLSCARDSYFIQGYAPDIALTRTSTIMQGGKRCDFRY
FT                   ALQRAPENGDA"
     atgacagaag tcaacccgac atccgccgcc gcacccgagg actcgcgcct cgggatcctc        60
     gcgcggcgcc gcatcgaagc ggaaatcatc aagccgatct acgagatcat gaagcgcgag       120
     ttcggcgccg agcgcgcgca ggccgtgatc gcggaagccg tgcgcggcgc ggccgtcgac       180
     gcgggtcgga cgttcgccgc gcaggagccg gacggcacga gcgtgaagtc gttcatcgcg       240
     ctgcaggtgc tgtgggagaa ggacgatgcg ctcgacgtcg aggtgcggcg cgcggacgac       300
     gcgcactacg actacgacgt gcatcgctgc agctacgcgg agatgtatca cgcgatgggg       360
     ctcggcgaga tcggccacct gctgagctgc gcgcgcgaca gctatttcat tcagggctat       420
     gcgccggaca tcgcgctcac gcgcaccagc acgatcatgc agggcggcaa gcgctgcgat       480
     ttccgctatg cgctgcaacg cgcgccggag aacggcgatg cgtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page