(data stored in ACNUC1104 zone)

EMBL: CP000959.PE24

CP000959.PE24        Location/Qualifiers
FT   CDS_pept        26169..26660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3209"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bvi:Bcep1808_4860 cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92365"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:B1K885"
FT                   /protein_id="ACA92365.1"
FT                   /translation="MTQPSAPLSTDLPPISCLPGDALPWLPMSADLPGLAIKYLHINAA
FT                   EDTLTALLKMPAGGVLPRHRHDGEVFVHTLQGAWRYREYDWVAHAGSTVLEPAGSVHTP
FT                   ETLGAPGEDVITLNVMRGDLVLLDDDGRETARENCRVALLRQRKHARTAPDAATAFVTR
FT                   "
     atgacgcagc cgtccgctcc gctctccacc gacctgccgc cgatctcgtg cctgcccggc        60
     gacgcgctgc cgtggctgcc gatgagcgcc gacctgccgg ggctcgcgat caagtacctg       120
     cacatcaatg cggccgagga cacgctgacc gcgctgctga agatgccggc cggcggcgtg       180
     ctgccgcgcc atcgtcacga tggcgaggta ttcgtccata cgctgcaggg tgcgtggcgc       240
     taccgcgaat acgactgggt cgcgcacgcc ggttcgacgg tgctcgaacc ggccggctcg       300
     gtgcatacgc cggaaacgct cggcgcgccg ggcgaggatg tgatcacgct gaacgtgatg       360
     cgcggcgacc tcgtgctgct cgacgacgac ggccgcgaaa cggcgcgcga gaactgccgc       420
     gtcgcgctgc tgcgccagcg caagcatgcg cgtacggcgc cggacgcggc cacggcgttc       480
     gttacgcggt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page