(data stored in ACNUC1104 zone)

EMBL: CP000959.PE241

CP000959.PE241       Location/Qualifiers
FT   CDS_pept        294298..295194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3429"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B1951
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92582"
FT                   /db_xref="GOA:B1K203"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K203"
FT                   /protein_id="ACA92582.1"
FT                   /translation="MKNIEQLPHDPPLRAVRAFEAFARLGSVTAAAGELDITPSAVSHQ
FT                   LQLLEAFIQTPLTVREGRLLALTDEGRDYYRSISAAFSVLRSATRFVRDRSSLRQITVS
FT                   LIPLLGIGWFIPRLHAFLADNTDVDVTVLYAHHRNYRSDASDLSIRFGTGDWPGYRCER
FT                   LLPGAMVPMCSPSFLKRHGPFRTPADLSRAPLVHDEDRSTWVNWLQGAGVRHVSHVVGP
FT                   MFEDGQLTLSAARADLGAALLRAPLVQRELANGELVQLFDHALDDGRDYYLCTREDADM
FT                   PDGARRLAEWLREMAGI"
     atgaaaaata tcgaacaatt gccgcacgat ccgccgctgc gcgcggtacg tgcattcgaa        60
     gcattcgcgc gtctcggctc ggtcaccgcg gcggcgggcg agctcgacat cacgccgtcg       120
     gcggtcagcc atcagctgca actgctcgag gcgttcatcc agacgccgct gacggtacgc       180
     gaaggccggc tgctcgcgct caccgacgag ggacgcgact actaccggtc gatcagcgcg       240
     gcgttctcgg tgctgcgcag cgccacgcgc ttcgtgcgag atcgttcatc gctgcgccag       300
     atcaccgtca gcctgattcc gctgctcggc atcggctggt tcattccgcg gctgcatgcg       360
     ttcctggccg acaacaccga tgtcgacgtc acggtgctgt acgcgcatca ccgcaactac       420
     cgaagcgatg cgtcggatct gtcgatccgc ttcggcaccg gcgactggcc cggctaccgc       480
     tgcgagcggc tgctgccggg cgcgatggtg ccgatgtgca gcccgtcgtt cctgaagcgt       540
     cacgggccgt tccgcacgcc ggccgatctc tcgcgcgcgc cgctggtgca tgacgaggat       600
     cgcagcacgt gggtcaactg gctgcagggc gccggcgtaa ggcacgtgtc gcacgtggtg       660
     gggccgatgt tcgaggacgg ccagctcacg ctgagcgccg ctcgcgccga tctcggcgcc       720
     gcgctgctgc gcgcgccgct ggtccagcgc gaactggcga acggcgagct ggtgcaactg       780
     ttcgatcacg cgctggacga cgggcgtgat tactacctgt gcacgcgcga ggacgcggac       840
     atgccggacg gggcgcggcg gctggcggaa tggttgcggg agatggcggg gatttga          897
//

If you have problems or comments...

PBIL Back to PBIL home page