(data stored in ACNUC1104 zone)

EMBL: CP000959.PE244

CP000959.PE244       Location/Qualifiers
FT   CDS_pept        296159..296722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3432"
FT                   /product="peroxiredoxin"
FT                   /note="TIGRFAM: peroxiredoxin; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Redoxin domain protein; KEGG: bam:Bamb_3501 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92585"
FT                   /db_xref="GOA:B1K206"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1K206"
FT                   /protein_id="ACA92585.1"
FT                   /translation="MPIINTQIKPFKATAYHNGEFVPVSEENFKGKWSVVVFYPADFTF
FT                   VCPTELGDLADRYAEFQKLGVEIYGVSTDTHFTHKAWHDTSDTIAKIKYPLVGDPTLTL
FT                   SRNFDVLIEEEGMALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAAHPG
FT                   EVCPAKWTPGAETLTPSLDLIGKI"
     atgccgatca tcaacaccca aatcaagccg ttcaaggcaa ccgcttacca caacggcgaa        60
     ttcgtgcccg tgtcggaaga gaacttcaag ggcaagtggt ccgtcgtcgt gttctacccg       120
     gccgacttca cgttcgtctg cccgacggaa ctgggcgacc tcgccgaccg ttacgcggaa       180
     ttccagaagc tgggtgtcga aatctacggc gtgtcgaccg acacgcactt cacgcacaag       240
     gcatggcacg acacgtcgga cacgatcgcc aagatcaagt acccgctggt cggcgacccg       300
     acgctcacgc tgtcgcgcaa cttcgacgtg ctgatcgagg aagaagggat ggcgctgcgc       360
     ggtacgttcg tgatcaaccc ggaaggcgag atcaagctgt gcgaaatcca tgacaacggc       420
     atcggccgcg acgcaggcga actgctgcgc aaggtccagg ccgcgcaata catcgccgcg       480
     cacccgggtg aagtgtgccc ggccaagtgg acgccgggtg cggaaacact gaccccgtcg       540
     ctcgacctga tcggcaagat ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page