(data stored in ACNUC1104 zone)

EMBL: CP000959.PE245

CP000959.PE245       Location/Qualifiers
FT   CDS_pept        296841..298442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3433"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="TIGRFAM: alkyl hydroperoxide reductase, F subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_B1954 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92586"
FT                   /db_xref="GOA:B1K207"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1K207"
FT                   /protein_id="ACA92586.1"
FT                   /translation="MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIAS
FT                   LTDRVTVTERRDDAERKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKL
FT                   DDDVIEQIRALDGDYAFETFFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEV
FT                   ESRQIMAVPTMFLNGASFGQGRSSVKEILAKLDTGAGERAAKSLENKPVFDTLIVGGGP
FT                   AGAAAAIYSARKGIATGVVAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYD
FT                   VDIMDVQRADALIPGDVHQIRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAY
FT                   CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSL
FT                   PNVTIVTQAQTTELTGDGSKLNGLVYKDLRSGETKRVDLEGVFVQIGLVPNTEWLKGTV
FT                   ELSKHGEIVVDARGATSVPGVFAAGDVTTVPFKQIVIAVGEGAKASLGAFDYLIRQDVA
FT                   APAATAQSQVEEAVAA"
     atgctcgacg ccaatctcaa gaaccaactc aaagcgtacc tcgaaaagat cacgcgcccg        60
     atcgaactcg tcgcctcgct cgacgacagc gcgaaatcgc aggaactgct ggcgctgctg       120
     aacgagattg cgtcgctgac ggatcgcgtg accgtaaccg aacgccgcga cgacgccgag       180
     cgcaagccgt cgttctcgat cggcgagccc ggcaagccgg ccggcatccg cttcgccggc       240
     atcccaatgg gccatgaatt cacgtcgctc gtgctcgcgc tgctgcagac gggcggccat       300
     ccgatcaagc tcgacgacga cgtgatcgaa cagattcgcg cactcgacgg cgactacgca       360
     ttcgaaacgt ttttctcgct gtcgtgccag aactgcccgg aagtcgtgca ggcgctgaac       420
     gtgatgtcgc tgatcaaccc gcgcatccgc cacgtcgcaa tcgacggcgc gctgtttcag       480
     gatgaagtcg agtcgcgcca gatcatggcc gtgccgacga tgttcctgaa cggcgcatcg       540
     ttcggccagg gccgcagcag cgtgaaggaa atcctcgcga agctcgatac gggcgccggc       600
     gaacgcgcgg cgaagtcgct cgaaaacaag ccggtgttcg acacgctgat cgtcggcggc       660
     ggcccggcgg gcgcggctgc cgcgatctac tcggcacgca agggcatcgc gacgggtgtc       720
     gtggccgagc gcttcggcgg gcaggtgctg gacacgatgg cgatcgagaa cttcgtgtcg       780
     gttcaggaaa ccgaagggcc gaagttcgcg accgcactcg agcagcacgt gaagcagtac       840
     gacgtcgaca tcatggacgt gcagcgcgcc gacgcgctga ttccgggcga cgtgcatcag       900
     atccgcctcg cgaacggcgc ggtgctgaag gcgaagacga tcgtcctcgc gaccggcgca       960
     cgctggcgcg aaatcaacgt gccgggcgag cgcgaatacc gcaaccgcgg ggtcgcgtac      1020
     tgcccgcact gcgacggccc gctgttcaag ggcaagcgtg tcgcggtggt cggcggcggc      1080
     aactcgggcg tcgaggccgc gatcgacctc gccggcatcg tgaaggaagt cacgctgatc      1140
     gaatacggcg cgcaactgcg tgcggacgaa gtgctgcaac gcaagctgcg cagcctgccg      1200
     aacgtgacga tcgtcacgca ggcgcagacg accgaactga ccggcgacgg cagcaagctg      1260
     aacgggctcg tctacaagga tctgcgttcc ggtgaaacga agcgcgtcga cctcgaaggc      1320
     gtgttcgtgc agatcggcct cgtgccgaac accgaatggc tgaaaggcac ggtcgaactg      1380
     tcgaagcacg gcgagatcgt cgtcgatgca cgcggcgcga cgtcggtgcc gggcgtgttc      1440
     gcggccggcg acgtgacgac ggtgccgttc aagcagatcg tgatcgcggt cggcgaaggg      1500
     gcgaaggcgt cgctcggcgc gttcgattac ctgatccggc aggacgtggc ggcgccggcg      1560
     gccactgcgc agtcgcaggt ggaagaagcg gtcgccgcct ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page