(data stored in ACNUC1104 zone)

EMBL: CP000959.PE255

CP000959.PE255       Location/Qualifiers
FT   CDS_pept        309983..310930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3443"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_3492 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92596"
FT                   /db_xref="GOA:B1K217"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K217"
FT                   /protein_id="ACA92596.1"
FT                   /translation="MSHLPPLSALRAFEAAVRLGGFARAAVELNVSTSAVSHQIRSLEE
FT                   SLGARLLERSTGLGGISLTPAGTRLLPAVSDALSRLTDACAEIRGTAQRLTVSANAPFS
FT                   SMWLARRLAEFSSLHPDTPLHAVVLDDEPDFARSGIDLAIVHVPAHRLRADDDVLMRET
FT                   VFPVCSPELFPYASGYVCRSRLLQEMHEDSPEIDWRNWAVHFGLPDDFDTKIVRYSSFS
FT                   QVIGAAVGGAGIALGRVPLIEPELRSGRLVPLVPGLSRDASWRFVLRRHPSTRHRLLDP
FT                   LIAFLRSEADAPPFVSKKVVPASNDSHARGAGGA"
     atgtcgcacc ttcctcccct cagcgcactg cgtgctttcg aggcggccgt ccgcctcggc        60
     gggttcgcgc gcgcggcggt cgagctgaac gtgtcgacca gcgcggtcag ccaccagatc       120
     cgttcgctcg aggaatcgct gggtgcaagg ctgctcgaac gcagcacggg gctcggcggc       180
     atcagcctca cgccggccgg tacgcgcctg ctgccggccg tcagcgatgc gctgtcgcgt       240
     ctcaccgacg cgtgcgccga gattcgcggc accgcgcaac ggctcaccgt atccgccaac       300
     gcgccgtttt cgtcgatgtg gctcgcacgc cggctggcag aattctcgtc gctgcatccc       360
     gacaccccgc tgcatgcggt cgtgctcgac gacgagccgg atttcgcgcg cagcggcatc       420
     gacctcgcga tcgtgcacgt gcccgcgcac cggctgcgcg ccgacgacga cgtgctgatg       480
     cgggaaaccg tgtttccggt ctgcagcccc gagctgtttc cgtacgcatc ggggtacgtc       540
     tgccgctcgc ggctgctgca ggagatgcac gaggacagcc ccgagatcga ctggcgcaac       600
     tgggcggtgc atttcggctt gccggacgac ttcgacacga agatcgtccg ctacagcagt       660
     ttcagccagg tgatcggcgc ggccgtcggc ggcgcgggca tcgcgctcgg ccgcgtgccg       720
     ctgatcgagc ccgaactgcg cagcgggcgt ctggtgccgc tggtgccggg cctctcgcgc       780
     gacgcgtcat ggcgcttcgt gttgcgccgc catccgtcga cgcggcaccg gctgctcgat       840
     ccgttgatcg cgttcctgcg cagcgaagcg gacgcgccgc cgttcgtctc gaagaaggtt       900
     gtgcccgcat ccaatgacag tcacgcacga ggcgcgggcg gcgcctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page