(data stored in ACNUC1104 zone)

EMBL: CP000959.PE256

CP000959.PE256       Location/Qualifiers
FT   CDS_pept        complement(310976..311347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3444"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bur:Bcep18194_B1964 membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92597"
FT                   /db_xref="GOA:B1K218"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B1K218"
FT                   /protein_id="ACA92597.1"
FT                   /translation="MTTSQLCLFIVALLPFPMTFLAKARKGYDNRAPRDYLAKLEGWRA
FT                   RAQAAHQNAWEALALFTAALVVAWHNGANVHRVDQLAMAFVAIRIVYALMYLLNWASLR
FT                   SLVWFGGMACIVALFFATP"
     atgacgacgt cccagctgtg cctgttcatc gtggcgctgt tgccgttccc gatgacgttt        60
     ctcgccaagg cccgcaaggg ttacgacaac cgcgcgccgc gcgattacct ggcgaagctc       120
     gaaggctggc gcgcccgcgc ccaggccgcc catcagaatg cgtgggaggc gctcgcgctg       180
     ttcacggccg cgctggtggt ggcgtggcac aacggcgcga acgtgcatcg cgtcgaccag       240
     ctcgcgatgg cgttcgtcgc gatccgcatc gtctatgcgc tgatgtacct gctgaactgg       300
     gcgtcgctgc gttcgctcgt gtggttcggc gggatggcgt gcatcgtcgc gctgttcttc       360
     gccacgccgt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page