(data stored in ACNUC1104 zone)

EMBL: CP000959.PE264

CP000959.PE264       Location/Qualifiers
FT   CDS_pept        complement(318510..319469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92605"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2G0"
FT                   /protein_id="ACA92605.1"
FT                   /translation="MTEDQPVSKVLVLDDSRVHADAIKRFCDAHNLVGLTVRRSRLLKV
FT                   LRSNIDLGAILLAEDYGGSPAESAIIATQIDALRPELPIILRRESLASRDGLPDALARV
FT                   ACAAYVADDMTPLERAIDEYLFGRDYPNALMRGISEITEARIDSLFPGMTIEHDTPCIV
FT                   RDQIIFGEVFSLIALESAWCRGYMLLQTSEQPLLDMLGGTRDGGRAPDFRDVNSVLGEL
FT                   TNLVWGAFKNRYLGDAEALARHPVQVPLVVNHKQKFISFGGDCPQLCFKYRMTDPASGR
FT                   SVRLDQRFVFSLSWSPEDFRESVQDVGPMVEAGELELF"
     atgaccgaag accaacccgt cagcaaggtg ctcgtgctcg atgacagccg cgtgcacgcc        60
     gatgcgatca agcgtttctg cgacgcgcac aacctggtcg gcctgaccgt gcggcgcagc       120
     cggctgctga aggtgctgcg ctcgaacatc gatctcggcg cgatcctgct ggctgaggat       180
     tatggcggct cgccggccga gagcgcgatc atcgcgacgc agatcgacgc gctgcgcccg       240
     gaactgccga tcatcctgcg ccgcgaatcg ctggcgtcgc gcgacgggct gcccgatgcg       300
     ctcgcgcggg tcgcgtgcgc ggcctacgtc gccgacgaca tgacgccgct cgagcgcgcg       360
     atcgacgaat acctgttcgg ccgcgactac ccgaacgcgc tgatgcgcgg catctcggag       420
     atcaccgagg cgcgcatcga cagcctgttc ccgggcatga cgatcgagca cgacacgccg       480
     tgcatcgtgc gcgaccagat catcttcggc gaggtgttca gcctgatcgc gctcgaaagc       540
     gcatggtgcc gcggctacat gctgctgcag acgagcgagc agccgctgct cgacatgctc       600
     ggcggcacgc gcgacggcgg ccgcgcgccg gatttccgcg acgtgaacag cgtgctcggc       660
     gagctgacca acctcgtgtg gggcgcgttc aagaaccgct atctcggcga cgccgaggcg       720
     ctggcgcgcc atccggtgca ggtgccgctc gtcgtcaatc acaagcagaa gttcatctcg       780
     ttcggcggcg actgtccgca gctttgtttc aagtaccgga tgaccgatcc ggcatcgggg       840
     cgttcggtcc gtctcgacca gcgtttcgtg ttcagcctga gctggtcgcc ggaggatttc       900
     cgcgaatcgg tgcaggacgt ggggccgatg gtcgaggcgg gcgaactcga actgttttga       960
//

If you have problems or comments...

PBIL Back to PBIL home page