(data stored in ACNUC1104 zone)

EMBL: CP000959.PE265

CP000959.PE265       Location/Qualifiers
FT   CDS_pept        complement(319495..320076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92606"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2G1"
FT                   /protein_id="ACA92606.1"
FT                   /translation="MISAQARAGFERIFFDAARTRLAAGGTCDIRPAAGHDPDAPDRRY
FT                   AKSRSKPKVPEHVVVLTISALHFRLLLALRFSDDDATRRHFAGATAGTNSQRPLTDAFM
FT                   EVANLCCGAINQALTTPFPDLGMSTPYLLSGASIDYLHALAPDYVAAYDLTLDGDVRVG
FT                   ATLCVCANAPVDFHVPETAAVDTGGELELF"
     gtgatcagcg cgcaggcgag ggcgggtttc gaacggatct tcttcgatgc cgcgcgcacg        60
     cggctcgccg ccggcggcac gtgcgacatc cggccggccg ccggtcacga ccccgacgcg       120
     cccgatcggc ggtacgcgaa gtcgcgatcg aagccgaagg tgcccgagca tgtggtcgtg       180
     ctgacgatct cggcgctgca tttccgcctg ctgctcgcgc tgcgcttcag cgacgacgac       240
     gcgacacgcc gccatttcgc cggcgcgacg gcgggcacga acagccagcg gccgctgacc       300
     gacgcgttca tggaagtcgc gaacctgtgt tgcggcgcga tcaaccaggc attgaccacg       360
     ccgtttcccg atctcgggat gtcgacgcct tacctgctga gcggcgcgag catcgactac       420
     ctgcacgcgc tggcacccga ttacgtggcc gcgtacgacc tgacgctcga cggcgacgtg       480
     cgggtcggcg cgacgctgtg cgtgtgcgcg aacgcgccgg tcgatttcca cgtgccggaa       540
     acggccgcgg tggacaccgg cggcgagctc gaactgttct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page