(data stored in ACNUC1104 zone)

EMBL: CP000959.PE269

CP000959.PE269       Location/Qualifiers
FT   CDS_pept        complement(324480..325985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3457"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bur:Bcep18194_B1983 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92610"
FT                   /db_xref="GOA:B1K2G5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2G5"
FT                   /protein_id="ACA92610.1"
FT                   /translation="MTHPSERPAGPAGGADAAHADPDAMFASHEAGYAKQLKPRHVQMI
FT                   AMGGAIGTGLFLGAGGRLQSAGPALALVYLVCGVFAFLIMRALGELVMHRPTSGSFVSY
FT                   AREFMGERASFVAGWMYYLNWATTGIVDITAVAIYMKYWAVFTDVPQWVFALGALGIVS
FT                   VMNMIGVKVFGEMEFWFSLVKVGTLAVFLAVGAVFLASGHPVAGQMTGLHLVADHGGIF
FT                   PHGILPAVLIVQGVVFAYASIELVGVAAGETADARKVLPKAINSVMWRIALFYVGSVVL
FT                   LTMLLPWTAYSAHESPFVTFFSKLGVPYVGTVMNVVVLTAALSSLNSGLYSTGRVLRSL
FT                   AMGGSAPRFVSRMNARGVPYGGILITVAINAIGVPLNYIVPAQAFEIVLNMASLGIITT
FT                   WGFIVMCQILFRRAVDRGEMKAVSFRMPGAPFTSWLTLAFLVGVLVLMAFDYPGGTWTI
FT                   ATIPVVVLALVIGWKLAKRGAERERAAAMPASVRGVADPARNA"
     atgacacacc ccagcgagcg cccggccggc ccggccggcg gcgcggatgc cgcgcatgcc        60
     gaccccgatg cgatgttcgc gtcgcacgaa gcgggctacg cgaagcagtt gaagccgcgg       120
     cacgtgcaga tgatcgcgat gggcggagcg atcggcaccg gcctctttct cggcgcgggc       180
     gggcgcctgc aaagcgcggg gccggcgctc gcgctcgtgt atctcgtgtg cggcgtgttc       240
     gcgttcctga tcatgcgcgc gctcggcgag ctcgtgatgc accggccgac cagcggcagc       300
     ttcgtgtcgt acgcacggga gttcatgggc gagcgcgcgt cgttcgtcgc gggctggatg       360
     tactacctga actgggcgac gaccggcatc gtcgacatca ccgcggtcgc gatctacatg       420
     aagtactggg ccgtgttcac cgacgtgccg caatgggtgt tcgcgctcgg cgcgctcggg       480
     atcgtgtcgg tgatgaacat gatcggcgtg aaggtgttcg gcgagatgga gttctggttc       540
     tcgctcgtca aggtcggcac gcttgcggtg tttctcgcgg tcggcgcggt gtttctcgcg       600
     agcggccatc cggtggcggg gcagatgacg ggactgcatc tcgtcgcgga tcacggcgga       660
     atcttcccgc acggcatcct gccggccgtg ctgatcgtgc agggcgtcgt gttcgcgtac       720
     gcgagcatcg agctcgtcgg cgtcgccgcg ggcgagacgg cggacgcgcg caaggtgctg       780
     ccgaaggcga tcaacagcgt gatgtggcgc atcgcgctgt tctatgtcgg ctcggtcgtg       840
     ctgctgacga tgctgctgcc gtggaccgcg tacagcgcgc acgaaagtcc gttcgtcacg       900
     ttcttcagca agctcggtgt gccgtacgtc ggcacggtga tgaacgtcgt ggtgctgacc       960
     gccgcgctgt cgagcctgaa ttccggcctc tattcgacgg gccgcgtgct gcgctcgctc      1020
     gcgatgggcg gctcggcgcc gcgtttcgtg tcgcggatga acgcgcgcgg cgtgccgtac      1080
     ggcgggatcc tgatcacggt cgcgatcaac gcgatcggcg tgccgctcaa ctacatcgtg      1140
     ccggcccagg cgttcgagat cgtgctgaac atggcgtcgc tcgggatcat cacgacgtgg      1200
     ggcttcatcg tgatgtgcca gatcctgttc cgccgcgcgg tcgatcgcgg cgagatgaag      1260
     gccgtgtcgt tccggatgcc cggcgcgccg ttcacgtcgt ggctcacgct cgctttcctg      1320
     gtcggcgtgc tggtgctgat ggcgttcgac tatccgggcg gcacgtggac catcgcgacg      1380
     attcccgtcg tcgtgctcgc gctggtgatc ggctggaagc tggcgaaacg cggcgccgag      1440
     cgcgagcggg cggcggcgat gccggcatcc gtgcgtggcg ttgcggaccc tgcgcggaac      1500
     gcgtga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page