(data stored in ACNUC1104 zone)

EMBL: CP000959.PE27

CP000959.PE27        Location/Qualifiers
FT   CDS_pept        29101..29901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3212"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bur:Bcep18194_B1706 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92368"
FT                   /db_xref="GOA:B1K888"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1K888"
FT                   /protein_id="ACA92368.1"
FT                   /translation="MTQAHRGTALITGASSGIGAVYADRLARRGYDLILVARNRDRLSA
FT                   LAERITNDTQRSVEIVDADLNDRAALAGVEAKLKQDASITLLVNNAGIGTHAPLLDSDV
FT                   DAMTRMIDLNVTALTRLTYAAVPGFVARGHGAVINIASIVAISPETLNGVYGGSKAFVL
FT                   AFSQSLHHELADKGVQVQAVLPGATATEFWQTGGLPLEHLPKEIVMTAPDMVDAALIGF
FT                   DRGELVTIPSLHAGDEWEAYEAARRTMAPHLSANTPAPRYTAAR"
     atgacgcaag cacatcgcgg taccgccctc attaccggcg cgtcgtcggg catcggcgcc        60
     gtctacgcgg accgcctcgc gcgccgcggc tacgacttga tcctggtcgc gcgcaatcgc       120
     gaccggctga gcgccctcgc cgagcgcatc acgaacgaca cgcagcgcag cgtcgagatc       180
     gtcgacgcgg acctcaacga ccgcgcggcg ctcgccggcg tcgaagccaa gctgaaacag       240
     gacgcgagca tcacgctgct cgtgaacaac gcgggcatcg gcacgcatgc gccgctgctc       300
     gacagcgacg tcgacgcgat gacgcggatg atcgacctga acgtgaccgc gctcacgcgc       360
     ctgacctatg cggccgtgcc cggcttcgtc gcacgcggcc acggcgcggt gatcaacatt       420
     gcgtcgatcg tcgcgatctc gccggaaacg ctgaacggcg tgtacggcgg cagcaaggcg       480
     ttcgtgctcg cgttcagcca gtcgctgcat cacgagctcg ccgacaaggg cgtgcaggtg       540
     caggccgtgc tgcccggcgc gacggccacc gagttctggc agacgggcgg cctgccgctc       600
     gagcacctgc cgaaggaaat cgtgatgacg gcgccggaca tggtcgatgc ggcgctgata       660
     gggttcgatc gcggcgaact cgtgacgatc ccgtcgctgc atgcgggcga cgaatgggag       720
     gcgtacgagg ccgcgcgccg cacgatggcg ccgcatttat cggccaatac gcccgcgccg       780
     cgctacaccg cggcgcgcta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page