(data stored in ACNUC1104 zone)

EMBL: CP000959.PE274

CP000959.PE274       Location/Qualifiers
FT   CDS_pept        complement(330732..331472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92615"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H0"
FT                   /protein_id="ACA92615.1"
FT                   /translation="MTSITLDLGSGKRATLTRATGSIGASRSMGQRSAVSELMLHWPKY
FT                   AGLTANALAYMRQLGLDVLQGTPLDALKSAIEIGRVALEIDRRVGEGGGSGGGQPSTPP
FT                   FPRASVPRMTSLPADKPLPSWVMPDDVSGDSLLAYLESVVGGSGAGCTAGFTCGASSLL
FT                   GDAQPFDYAARTIGERVESLAAATNNPNFAAKMLGYDRKTFGQMLHILKPANGLGPADN
FT                   VIFHDSGDVEFKGVIIDNIHDYAR"
     atgacgtcga taactctcga tttaggttca ggaaaacgcg cgacattgac tcgcgccaca        60
     ggttctatcg gcgcaagccg ttcgatgggg caacgtagcg ccgtttcgga attgatgctg       120
     cactggccga aatatgcggg cctcactgcc aacgcgttgg cgtacatgcg gcaactcggt       180
     ctggacgtgc ttcagggcac gccgcttgac gcgctcaaat ccgccataga aatcggtcgc       240
     gtagcgctcg agattgaccg cagggtaggc gagggtggcg gtagcggtgg cggccagccg       300
     tcaaccccac ccttcccgcg tgccagcgtg ccgcgaatga cttcgctgcc ggccgacaaa       360
     cccctgccga gttgggtgat gcctgacgac gtgtccggcg actcgctgtt ggcctacttg       420
     gaaagcgttg ttggcggcag tggcgccggc tgcacagccg gttttacgtg cggtgcctca       480
     tcattgctcg gagatgcgca gcccttcgac tatgccgcac gcacaattgg cgagcgtgtt       540
     gaatcgcttg ccgcggcgac caacaatccg aactttgcgg caaagatgct cggctacgat       600
     cgcaagacgt tcgggcagat gctgcatatc ttgaagcccg ccaacggctt gggacctgcc       660
     gacaacgtta tcttccacga cagcggcgac gttgaattca aaggcgtaat tattgataac       720
     atccatgact atgcacgctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page