(data stored in ACNUC1104 zone)

EMBL: CP000959.PE275

CP000959.PE275       Location/Qualifiers
FT   CDS_pept        complement(332064..332387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92616"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H1"
FT                   /protein_id="ACA92616.1"
FT                   /translation="MDKLISYVAAIHGLAGSVSIVSHATSHDRWTDDDVEVIRDETEYR
FT                   FDNGAIVRRSVEQDRAPSDLLCAECWIDYDVLRHPDAQPINPSRLTFDNACRETFWLRY
FT                   HLA"
     atggacaagc ttatttccta cgtcgccgcg atccacgggc tcgccggctc cgtgtcgatc        60
     gtgtcgcacg cgacatcgca cgatcgctgg accgacgacg acgtcgaggt catccgcgac       120
     gaaaccgaat accggttcga caacggcgcg atcgtgcgcc gctcggtcga gcaggaccgt       180
     gcgccgtccg acctgctgtg cgccgaatgc tggatcgact acgacgtgct gcgccatccc       240
     gatgcgcagc cgatcaaccc gtcgcggctg acgttcgaca acgcatgccg cgaaaccttc       300
     tggctgcggt accacctcgc gtga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page