(data stored in ACNUC1104 zone)

EMBL: CP000959.PE276

CP000959.PE276       Location/Qualifiers
FT   CDS_pept        complement(332504..333526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92617"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H2"
FT                   /protein_id="ACA92617.1"
FT                   /translation="MTDRLTPELASKFAALALAHLTREYPNKLTHALEGPHDVQGPRAL
FT                   HPIFYGSYDWHSCVHGYWLVLRVLERYPALPEAERIVATVDAHFTDANVAGERAYLALP
FT                   HNAGFERPYGWAWLLALAAQLERLALKGALPQAARWAKTLAPLADLFVSRFETFLPKAT
FT                   YPLRVGTHFNTAFALALTLDFARDTQRDGLAALIVDTAKRWHLNDVACQAWEPSGDEFL
FT                   SPALMEAELMRRVLPAAEFDGWFARFLPDLAHGEPATLFEPATVSDRSDGKIAHLDGLN
FT                   LSRAWCQRSLAGALPEGDARRAKLLDAADRHLASALAHVAGDYMGEHWLATFALLALDA
FT                   "
     atgaccgacc gactcacccc cgaactcgcg tcgaaattcg cggcgctcgc gctcgcgcac        60
     ctgacccgcg aatatccgaa caagctcacg catgcgctcg aagggccgca cgacgtgcag       120
     gggccgcgcg cattgcatcc gatcttctac ggcagctacg actggcactc gtgcgtgcac       180
     ggctactggc tcgtgctgcg cgtgctcgaa cgctacccgg cattgccgga ggccgagcgc       240
     atcgtcgcga ccgtcgatgc gcatttcacc gacgcgaacg tcgccggcga gcgcgcgtat       300
     ctcgcgctgc cgcacaacgc cggcttcgag cggccgtacg gctgggcgtg gctgctcgcg       360
     ctcgccgcgc agctcgagcg gctcgcgctg aagggcgcgc tgccgcaggc cgcgcgctgg       420
     gcgaagacgc tggcgccgct ggccgacctg ttcgtgtcgc gcttcgagac gttcctgccg       480
     aaggcgacct atccgctgcg cgtcggcacg catttcaaca ccgcgttcgc gctggcgctc       540
     acgctcgatt tcgcccgcga tacacagcgc gacgggctcg cggcgctgat cgtcgatact       600
     gcgaagcgct ggcacctgaa cgacgtcgca tgccaggcgt gggagccgtc gggcgacgaa       660
     ttcctgtcgc ccgcgctgat ggaagctgaa ctgatgcggc gggtgctgcc ggccgccgaa       720
     ttcgacggct ggttcgcgcg cttcctgccc gatctcgcgc acggcgagcc ggcgacgctg       780
     ttcgagccgg cgacggtcag cgaccgcagc gacggcaaga tcgcgcacct cgacgggctg       840
     aacctgagcc gcgcgtggtg ccagcgttcg ctggccggcg cgctgccgga aggcgatgcg       900
     cggcgcgcga agctgctcga tgcggccgat cggcatctcg cgagcgcgct cgcgcacgtg       960
     gccggcgatt acatgggcga gcactggctc gcgacgttcg cattgctggc gctggacgcg      1020
     tag                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page