(data stored in ACNUC1104 zone)

EMBL: CP000959.PE280

CP000959.PE280       Location/Qualifiers
FT   CDS_pept        complement(335727..336155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92621"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H6"
FT                   /protein_id="ACA92621.1"
FT                   /translation="MSAPYTVLVSRNPYAPIVIEQDGRLLYRIHIESGHASFDRDFPVE
FT                   PDAVRVLRDDAERYYFLFAALHHPYQLSATNLSDAERERYFGTILFAGRDEVEAFMTER
FT                   DRASNGAVANLLSIFTQADYRQLREGRWFGMGAGMPAA"
     atgagcgcgc cctataccgt cctcgtcagc cgcaacccgt acgcgccgat cgtgatcgag        60
     caggacggcc gcttgctgta ccggatccac atcgagagcg ggcacgcgtc gttcgaccgc       120
     gattttccgg tcgaacccga tgcggtgcgg gtgctgcgcg acgatgccga gcgctactac       180
     ttcctgttcg cggcgcttca ccatccgtac cagctgagcg cgacgaacct ctccgacgcg       240
     gagcgcgagc gttatttcgg cacgatcctg ttcgccggcc gcgacgaagt cgaagccttc       300
     atgacggaac gcgatcgtgc cagcaacggc gcggtggcga acttgctgag catcttcacg       360
     caggccgatt accggcaact gcgcgagggc cggtggttcg gcatgggcgc gggcatgccg       420
     gccgcgtag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page