(data stored in ACNUC1104 zone)

EMBL: CP000959.PE283

CP000959.PE283       Location/Qualifiers
FT   CDS_pept        complement(338924..341173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3471"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold domain protein; KEGG: bur:Bcep18194_B2019
FT                   diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains)
FT                   with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92624"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2H9"
FT                   /protein_id="ACA92624.1"
FT                   /translation="MNTEPQSSRYSLGLAAEVLASEQSVLRLITRNTPLPELLVEVCRR
FT                   AEALLGDGACCTILLLDTDGVHVRVGAAPSLPAQYSAAIDGATIGPAAGSCGTAMYERR
FT                   MIAVEDIETDPLWADYRAIALPLGLRACWSVPFLDEAGAVLGAFAVYHHRPCRPSDEET
FT                   ALLRDIGNSVGLAVHQDRIARQLARSEEHHRLVVNSLSEGILVISREGIVIASNPSANR
FT                   MMRVKGELVGRRLSTVILRKLREDGTPIDPHDWPSRRALETATPMLDYTVGFGLADGDI
FT                   IWVRGNAVPIVRPGETQADSVLVSFNDIGPVREAQQQLRYMATRDALTGLYNRRWLGDR
FT                   MRELFCVRDAAAGPARVAILFIDLVGFKKVNDTAGHDAGDALLRSVAARLAACGEGRYA
FT                   LTRVGGDEFVILVDDCDDPDRLSVLAREVIEAIAKPFAIANNEYWLGVSIGISVAPRDG
FT                   DDAATLMRNADSAMYDAKQRGRNHFTFFTAQLNLRLQRRFAIEQSLRRALASDLLRLAY
FT                   QPVVDARSGRTVGAEALLRWTSPELGPMSPAEFIPVAEDTGLIVAIGQWVLETACRQVA
FT                   EWRRTIAPDLMLAVNLSPRQFHEGLVESVGRCLAQTRLDPSALELEITEGVLMNDTDTV
FT                   LPMLEALTDMNVRISVDDFGTGYSSLAYLKRFPLHNLKVDRSFVSGVPDHHDSVAITQA
FT                   VVAMAHSLGMKVTAEGVETQAQSWFLQQIGCDMQQGYLFSRPLDASDYARRLGAA"
     ttgaataccg aaccgcaaag ttctcgctac agcctcgggc tcgccgcgga agtgctcgca        60
     tccgagcaga gcgtactgag gctgatcacg cgcaacacgc cactgccgga actgttggtc       120
     gaggtttgcc ggcgtgccga ggctttgctc ggcgacggcg cgtgctgcac gatcctgctg       180
     ctcgatacgg acggcgtgca cgtgcgcgtc ggcgcggcgc cgtcgttgcc cgcgcagtac       240
     agcgcggcga tcgacggcgc gacgatcggg cccgcggccg gctcgtgcgg cacggcgatg       300
     tacgagcgcc ggatgatcgc cgtcgaagac atcgaaaccg atccactgtg ggccgactac       360
     cgtgccatcg cgttgccgct gggcttgcgc gcgtgctggt cggtgccgtt cctcgacgag       420
     gcgggcgccg tgctcggcgc gttcgccgtc tatcaccacc ggccgtgccg gccgagcgac       480
     gaggaaaccg cgctgttgcg cgatatcggc aacagcgtcg gcctcgcggt gcaccaggac       540
     cggatcgcac gacaactcgc gcgcagcgag gaacatcacc ggctcgtcgt caacagcctg       600
     agcgagggca tcctcgtcat atcgcgcgaa ggcatcgtga tcgcgagcaa tccgagcgcg       660
     aaccggatga tgcgcgtgaa gggcgaactc gtcggccgcc ggctgtcgac ggtgatcctg       720
     cgcaagctgc gcgaggacgg cacgccgatc gacccgcacg actggccgag ccggcgcgcg       780
     ctcgagacgg ccacgccgat gctcgactat acggtcggct tcggtctcgc ggatggcgac       840
     atcatctggg tgcgcggcaa cgcggtgccg atcgtgaggc cgggcgagac gcaggccgac       900
     tcggtgctcg tgtcgttcaa cgacatcggc cccgtgcgcg aagcgcagca gcagttgcgc       960
     tacatggcga cccgcgacgc gctgacgggc ctctacaacc gccgctggct cggtgaccgc      1020
     atgcgcgagc tgttctgcgt gcgcgatgcg gcggccgggc ccgcgcgcgt cgcgatcctg      1080
     ttcatcgatc tggtcggctt caagaaggtc aacgacacgg ccggccacga cgccggcgac      1140
     gcgctgctgc gcagcgtcgc cgcgcggctc gcggcctgcg gggagggccg ctatgcgctc      1200
     acgcgcgtcg gcggcgacga gttcgtgatc ctcgtcgacg actgcgacga tcccgatcgc      1260
     ctgtcggtgc tcgcacgcga ggtgatcgag gcgatcgcga agccgttcgc gatcgcgaac      1320
     aacgaatact ggctcggcgt atcgatcggc atcagcgtcg cgccgcgcga cggcgacgat      1380
     gccgcgacgc tgatgcgcaa cgccgattcg gcgatgtacg acgcgaagca gcgcggccgc      1440
     aaccacttca cgttcttcac cgcgcagctc aacctgcggc tgcagcgccg cttcgcgatc      1500
     gagcagtcgc tgcggcgcgc gctcgcgtcg gacctgctgc ggctcgcgta tcaacccgtc      1560
     gtcgatgcgc gcagcggccg cacggtcggc gccgaggcgc tgctgcgctg gacgagcccc      1620
     gagctcgggc cgatgtcgcc ggcggaattc attccggtcg cggaagatac cgggctgatc      1680
     gtcgcgatcg gccagtgggt gctcgaaacc gcgtgccggc aggtggccga gtggcgccgc      1740
     acgatcgcgc cggacctgat gctggccgtc aacctgtcgc cgcggcagtt tcacgagggg      1800
     ctcgtcgaat cggtcggccg ctgtctcgcg cagacgcggc tcgacccgtc ggcgctcgaa      1860
     ctggagatca ccgaaggcgt gctgatgaac gacacggaca ccgtgctgcc gatgctcgag      1920
     gcgctcacgg acatgaacgt gcggatctcg gtcgacgatt tcggcaccgg ctattcgtcg      1980
     ctcgcgtacc tgaagcgctt tccgctgcac aacctgaagg tcgaccgctc gttcgtttcg      2040
     ggcgtgcccg atcatcacga ctcggtcgcg atcacgcagg cggtcgtcgc gatggcgcat      2100
     tcgctcggga tgaaggtcac ggccgaaggc gtcgagacgc aggcgcagtc gtggtttctg      2160
     cagcagatcg gctgcgacat gcagcagggc tatctgttca gccggccgct ggacgcgagc      2220
     gattacgcgc gccggctcgg cgccgcgtaa                                       2250
//

If you have problems or comments...

PBIL Back to PBIL home page