(data stored in ACNUC1104 zone)

EMBL: CP000959.PE288

CP000959.PE288       Location/Qualifiers
FT   CDS_pept        complement(345146..346105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2031
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92629"
FT                   /db_xref="GOA:B1K2I4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2I4"
FT                   /protein_id="ACA92629.1"
FT                   /translation="MRHATEPVSGNLNWDDLRFFLEVARTQRASGAAKRLGVDYTTVAR
FT                   RIRALEAAMGTLLFDKSRSGGFTLTAEGQRLVAYADAMETTVQSACDQVANTGEALSGH
FT                   VRIGSTEGFGCFFLAPQLARFRAAHPHVTVDLLPVPHFVNLPKREADLAITLERPERGP
FT                   YVVTKLCDYQLRLYATRDYLANHAPITCTDDLARHAFISYVDDLAFSNELLYLDRAVPG
FT                   ATAGLRTTSVIAQVFAALQGGGLAILPCFMAATQPALAPVLPNDVVVTRCFWLTCREDL
FT                   RKLRRVTALWDYLRAAADANRALLSGESATLRFVGEPA"
     atgcgacatg ccaccgagcc ggtttccggc aacctgaact gggacgacct gcgctttttc        60
     ctcgaggtcg cgcgcacgca gcgcgcgagc ggtgccgcga agcggctcgg ggtcgactac       120
     acgaccgtcg cgcggcgcat ccgcgcgctc gaggccgcga tgggcacgct gctgttcgac       180
     aagtcgcgct cgggcggctt cacgctgacg gcggaagggc aacggctggt cgcatatgcg       240
     gacgcgatgg agacgaccgt gcaatccgcg tgcgaccagg tcgcgaacac cggcgaggcg       300
     ctgtcgggcc acgtgcggat cgggtcgacc gaagggttcg gctgcttttt cctcgcgccg       360
     cagctcgcgc ggttccgcgc cgcgcatccg cacgtgacgg tcgacctgct gccggtgccg       420
     catttcgtca acctgcccaa gcgcgaggcc gatctcgcga tcacgctcga acggcccgaa       480
     cgcgggcctt acgtggtcac gaagctgtgc gactaccagt tgcggctcta tgcgacgcgc       540
     gactatctgg cgaaccacgc gccgatcacg tgcaccgacg atctcgcgcg gcacgcgttc       600
     atcagctacg tcgacgatct cgcattcagc aacgaactgc tgtacctgga ccgcgcggtg       660
     cccggcgcga cggcgggctt gcgcacgacc agcgtgatcg cgcaggtttt cgcggcgctg       720
     cagggcggcg gcctggcgat cctgccgtgc ttcatggcag ccacgcagcc ggcgctggcg       780
     cccgtgctgc cgaacgacgt ggtcgtcacg cggtgtttct ggctgacgtg ccgcgaggat       840
     ctgcgcaagc tgcggcgcgt gaccgcgctg tgggattacc tgcgcgcggc ggcggatgcg       900
     aatcgcgcgt tgctgtcggg ggaatcggct acgctgcgct tcgtcggcga gccggcatag       960
//

If you have problems or comments...

PBIL Back to PBIL home page