(data stored in ACNUC1104 zone)

EMBL: CP000959.PE292

CP000959.PE292       Location/Qualifiers
FT   CDS_pept        complement(350243..350485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92633"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2I8"
FT                   /protein_id="ACA92633.1"
FT                   /translation="MTATSNPNVYTVTTRTVGVSTTWADAHEKAVNEATNYCTQRGMRA
FT                   SVKQESLTGGRRVDARSELAFECHPTFETASNPRG"
     gtgaccgcga cgtcgaaccc gaacgtgtac accgtgacga cgcgcacggt cggcgtgtcg        60
     acgacgtggg ccgacgccca cgagaaggcc gtcaacgaag ccaccaacta ctgcacgcag       120
     cgcgggatgc gcgccagcgt gaagcaggaa tcgctgaccg gcggccgccg cgtcgacgcg       180
     cgttccgaac tcgcgttcga gtgccatccg accttcgaga cggcgtcgaa cccgcgcggt       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page