(data stored in ACNUC1104 zone)

EMBL: CP000959.PE30

CP000959.PE30        Location/Qualifiers
FT   CDS_pept        complement(32881..33840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bur:Bcep18194_B1711 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92371"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1K891"
FT                   /protein_id="ACA92371.1"
FT                   /translation="MAKAFASQADLEEKKVTWTKLSENAYAYTAEGDPNSGVIIGDDSV
FT                   LIVDTTATPAMAQDLIAKIRSVTDKPIKHVVLSHYHAVRVLGASAYFDEGAQHVIASRG
FT                   TYEMIVERGEADMKSEIERFPRLFAGVETVPGLTWPTLVFEREITLFLGKLEVKIMHVG
FT                   SGHTKGDTIVWLPSQKVLFSGDLVEYDAACYCGDAQLEQWPATLEALRALGAEKLVPGR
FT                   GPALLNPAEVNKGLDYTKDFVTTLLAQGRKAVERNLDLKAAMALTREAMDPKFGHVFIY
FT                   EHCLPFDVSRAFDEASGIAHPRIWTAQRDKDMWAALQD"
     atggccaaag cattcgcctc ccaagccgat ctggaagaga agaaagtcac ctggacgaag        60
     ctgtccgaga acgcgtacgc gtacacagcc gaaggcgacc cgaactcagg cgtgatcatc       120
     ggcgacgaca gcgtgctgat cgtcgacacg accgcgacgc ccgcgatggc gcaggaccta       180
     atcgcgaaga tccgcagcgt gaccgacaag ccgatcaagc acgtggtgct gtcgcactat       240
     cacgcggtgc gcgtgctcgg cgcgtccgcg tacttcgacg aaggcgcgca gcacgtgatc       300
     gcgagccgcg gcacctacga gatgatcgtc gagcgcggcg aggccgacat gaagtcggag       360
     atcgagcgct tcccgcgcct gttcgccggc gtcgagacgg tacccggcct gacctggccg       420
     acgctcgtgt tcgagcgcga gatcacgctg ttcctcggca agctcgaagt gaagatcatg       480
     cacgtcggct cgggccatac gaagggtgac acgatcgtct ggctgccgtc gcagaaggtg       540
     ctgttctcgg gcgacctcgt cgaatacgac gccgcgtgct attgcggcga cgcgcagctc       600
     gaacagtggc cggccacgct cgaggcgttg cgcgcgctcg gcgccgagaa gctcgtgccg       660
     ggccgcggcc ccgcgctgct gaatccggcc gaagtgaaca agggcctcga ctacacgaag       720
     gatttcgtca cgacgctgct cgcgcagggc cgcaaggccg tcgagcgcaa tctcgacctg       780
     aaggccgcga tggcgctcac gcgcgaagcg atggacccga agttcggcca cgtgttcatc       840
     tacgagcact gcttgccgtt cgacgtgtcg cgcgcgttcg acgaggcgag cggcatcgcg       900
     catccgcgca tctggaccgc gcagcgcgac aaggacatgt gggccgcgct gcaggactga       960
//

If you have problems or comments...

PBIL Back to PBIL home page