(data stored in ACNUC1104 zone)

EMBL: CP000959.PE308

CP000959.PE308       Location/Qualifiers
FT   CDS_pept        368266..369450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3496"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2041
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92649"
FT                   /db_xref="GOA:B1K2K4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K4"
FT                   /protein_id="ACA92649.1"
FT                   /translation="MRAPLDPTALPRCTSDATGALDVLDARLMRILLVLLTERTVSRAA
FT                   VRLNMSQPATSAALKRLRTLLGDPLLVRSRYGMVPTEFGARLIEPLRNALRVIDFIRIQ
FT                   QPTFDARTSVRTYRIGCPDYLNVLFVPKLVALFRERAPHAQLVFHPLGDGFDDERALAD
FT                   GDLDVVIDNRPVRQSRFRQDDLFDDRVVCLMRATHPLARRDAMTAAGFAVAPQLCPTPS
FT                   WLEASGAIDRQLERVGLQRRIVVTLPHFELAAHALVRTDLILTTTYRLARHYAKLLPLA
FT                   AVALPVEPPDIAYRMTWNESGSCAEGGRWLRVLIAEATRAWLDAEARLPAVAAVAAVAA
FT                   SGADADATNTAVVGTDPPEPTRRTRRRPATHCHASHPARVAQAARIHRGATKSH"
     atgcgggccc cgctagatcc aaccgccctg ccccgctgca cgtccgacgc cacgggcgcg        60
     ctcgacgtgc tcgatgcacg gctgatgcgc atcctgctcg tgctgctgac cgagcgcacc       120
     gtgtcgcgtg cggccgtgcg cctgaacatg tcgcagccgg cgacgagcgc cgcgctcaag       180
     cgcctgcgca cgctgctcgg cgatccgctg ctggtacgca gccgctacgg gatggtgccg       240
     accgaattcg gcgcgcggtt gatcgagccg ctgcgcaacg cgctgcgcgt gatcgacttc       300
     atccgcatcc agcagccgac gttcgacgcg cgcacgtcgg tgcgcaccta ccggatcggc       360
     tgccccgact acctgaatgt cctgttcgtg ccgaagctcg tcgcgctgtt tcgcgagcgt       420
     gcgccgcacg cgcaactggt gttccatccg ctcggcgacg ggttcgacga cgagcgcgcg       480
     ctggccgacg gcgacctcga cgtcgtgatc gacaaccggc ccgtgcgcca gtcgcgcttc       540
     cgccaggacg acctgttcga cgaccgcgtc gtatgcctga tgcgcgcgac gcacccgctc       600
     gcgcggcgcg acgcgatgac ggccgccggg ttcgcggtgg cgccgcaact gtgcccgacg       660
     ccgtcgtggc tcgaagcgtc cggcgcgatc gaccggcaac tcgaacgcgt gggcctgcaa       720
     cggcgcatcg tcgtcacgct gccgcacttc gagctcgccg cgcatgcgct ggtgcgcacc       780
     gacctgattc tcaccaccac gtaccggctc gcgcggcact atgcgaagct gctgccgctc       840
     gccgcggtcg cgctgccggt cgagccgccg gacatcgcgt accggatgac gtggaacgaa       900
     tcgggatcgt gcgcagaagg cggtcgatgg ctgcgcgtgc tgatcgccga ggcgacgcgc       960
     gcatggctcg acgccgaggc aaggttgccg gcggtcgcgg cggtcgctgc cgttgccgct      1020
     tccggggccg atgcggacgc aacgaacacc gcggtggtgg gcaccgatcc gcccgagccc      1080
     acccggcgca cgcgccgcag acctgccacc cattgccatg cgtcgcatcc ggcgcgcgtc      1140
     gcgcaggcgg cacgcatcca tcgcggcgcg acgaagtcgc actga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page