(data stored in ACNUC1104 zone)

EMBL: CP000959.PE31

CP000959.PE31        Location/Qualifiers
FT   CDS_pept        34019..35662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3216"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bur:Bcep18194_B1712 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92372"
FT                   /db_xref="GOA:B1K892"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K892"
FT                   /protein_id="ACA92372.1"
FT                   /translation="MQNHEVSADDAPPKAQRGIQSVEVGGRLLDALARRRKPLGLSELA
FT                   AAADLSTAQAHTYLVSLTRLALVKRDALTGNYEPGPLSLRLGLMSIERQPAYRATLPHA
FT                   VRLAETVGLSVALSVPGALGPTIVRIEHGGYPLHVNLHVGSVMSLDTTATGRVFRAFGD
FT                   AAQLAAMAASQAGAGATLAGAESPSVAPDAGAQPVELDAIRARGIERSIDRPSPGVSGM
FT                   CVPVLDAHGRLQLALTVIGSTGSIDVDWDGPIAAALRDAARQATASLGTEPAELAPAPG
FT                   VARVPPALADDAKTQRGINALDSTGDLLLALVSAGRALPLRDLATAAGMPAAKAFPHLV
FT                   SLQKIGLLSRDDAGCFDGGPLAQALGLIAMQRVSPTRDAEAEIVALAGATDMSVAAATL
FT                   GPLGPTVIRLEESARPQHVSLQVGTVMSLVNTAIGRIFASGMSDDVLADLLANEPVRLA
FT                   GAPPAPDDAAFRSRLATIRADELDFAFDAPVPGIGTIAAPVFDHTGSIRLVIAIIGSSR
FT                   GFPRGPDSELAQTLRAATRRLSWRFGWIGR"
     gtgcagaacc acgaagtcag cgcggacgat gcgccgccca aggcgcagcg cggcatccag        60
     agtgtcgagg tcggcggccg gctgctcgac gcgctcgcgc gccggcgcaa gccgctcggg       120
     ctgtcggaac tggccgcggc ggccgatctc tccaccgcgc aggcgcacac ctatctcgtg       180
     agcctgacgc ggctcgcgct cgtgaagcgc gacgcgctca ccggcaacta cgagccgggc       240
     ccgctgtcgc tgcggctcgg gctgatgtcg atcgagcgcc agccggccta ccgggcaacg       300
     ctgccgcatg cggtgcggct cgcggaaacg gtcgggctga gcgtcgcgct gtcggtgccg       360
     ggcgcgctcg gcccgacgat cgtgcgcatc gagcacggcg gctatccgtt gcacgtgaat       420
     ctgcacgtcg ggtcggtgat gtcgctcgac accacggcga ccggccgcgt gttccgggcg       480
     ttcggcgacg ccgcgcaact cgccgcgatg gcggccagcc aggcgggtgc gggcgcgacg       540
     ctcgccggcg ccgaaagccc gtcggtcgcg ccggacgctg gtgcgcaacc cgtcgaactc       600
     gatgcgatcc gcgcacgcgg catcgaacgc agcatcgacc ggccgagccc gggcgtcagc       660
     gggatgtgcg tgcccgttct cgatgcgcac gggcggctcc agctcgcgtt gacggtgatc       720
     ggttcgacgg gatcgatcga tgtcgactgg gacggcccga tcgcggcggc gttgcgcgat       780
     gcggcgcggc aagccaccgc gtcgctcggc acggaaccgg cggagctggc acccgcgcca       840
     ggcgtcgcac gcgtaccgcc cgcgctggcc gacgacgcga aaacgcagcg cgggatcaat       900
     gcgctcgaca gcaccggcga cctgctgctc gcgctggtgt cggcgggccg cgcgctgccg       960
     ctgcgcgatc tcgcgacggc ggccggcatg ccggccgcga aggcatttcc gcatctggtc      1020
     agcctgcaga agatcggcct gctgagccgc gacgacgccg gctgcttcga cggcggcccg      1080
     ctcgcgcagg cgctcggcct gatcgcgatg cagcgcgtgt cgccgacgcg cgacgcggaa      1140
     gccgagatcg tcgcgctcgc cggcgcgacc gacatgagcg tggccgccgc gacgctcggc      1200
     ccgctcgggc cgaccgtgat ccggctggag gaatcggcgc ggccgcagca cgtgagcctg      1260
     caggtcggca ccgtgatgtc gctcgtcaat acggcgatcg gccggatttt cgcgtccggc      1320
     atgtccgacg acgtgctggc cgacctgctc gccaacgagc cggtgcggct cgcaggcgcg      1380
     ccccccgcac cggacgacgc ggccttccgc tcacggctcg cgacgatccg cgcggacgag      1440
     ctcgatttcg cgttcgacgc gccggtgccg ggcatcggga cgattgccgc acccgtgttc      1500
     gatcacaccg gcagcatccg gctcgtgatc gcgatcatcg gctcgtcgcg cggcttcccg      1560
     cgcgggcctg acagcgagct ggcgcagacg ctgcgggccg caacgcggcg gctgtcgtgg      1620
     cgcttcgggt ggatcggccg ataa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page