(data stored in ACNUC1104 zone)

EMBL: CP000959.PE313

CP000959.PE313       Location/Qualifiers
FT   CDS_pept        373069..374316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92654"
FT                   /db_xref="GOA:B1K2K9"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2K9"
FT                   /protein_id="ACA92654.1"
FT                   /translation="MDISGSSIRREERPVRRWLTPGRIALYSAVMLVISVLLGAILLWV
FT                   GFHSTDSGTFRPGSGYMVFWSASHLMLHGSPWLAYDIPAFSRELATLFPVAGRHAFLPW
FT                   LYPPSYLLAVTPLALLPYAISYPVFVVLGIVLLGLAVWRVSGFGAVPGATRIGWLALFA
FT                   CPGVFVTAMYGQNAMLTTACAALAVYFVDRRPLLAGLCIGLLSVKPQMALLFPFVLIAA
FT                   RAWRAFAWAAAWATAITALGIAAGGMEPLRLFLQNAGALRSLIIEHGVPFWFASPTPFA
FT                   AFRLAGLSPALAYAGQAVIAAIALAAACFVWRRSRDARLRGAVLVVATLAANPYVWHYE
FT                   LSWLCIPIACMIAIGAQYGWRRGEQCVVAVMWALPMYEFLNPWLTLPQIGPAVTTTALL
FT                   VLLQRARTLPRSPARR"
     atggatattt ccggctcgtc gatacggcgc gaagaacgcc ccgtccgccg ctggctcacg        60
     cccggacgca tcgcgcttta cagcgcggtc atgctggtga tcagtgtgct gctgggcgcg       120
     atcctgctct gggtcggctt tcactcgacc gactccggca cgtttcgccc cggctcgggg       180
     tacatggtgt tctggtccgc gtcccatctg atgctccacg gctcgccgtg gctggcctac       240
     gacatccccg cgttctcgcg cgaactcgcc acgctgttcc cggtggccgg ccgccatgcg       300
     ttcctgccgt ggctgtaccc gccgtcgtat ctgctcgcgg tgacaccgct cgcgctgctg       360
     ccctacgcga tcagctatcc ggtgttcgtc gtactcggca tcgtgctgct cggcctcgcg       420
     gtgtggcgcg tgtcgggatt cggcgcggtg cccggcgcga cgcgcatcgg ctggctcgcg       480
     ctgttcgcct gcccgggcgt gttcgtcacc gcgatgtacg gacagaacgc gatgctgacc       540
     acggcgtgcg cggcgctcgc ggtgtacttc gtcgaccggc ggccgctgct ggccggcctc       600
     tgtatcggac tcctgtcggt caagccgcaa atggccctgc tgttcccgtt cgtgctgatt       660
     gccgcgcgag cgtggcgcgc gttcgcgtgg gccgcggcat gggcgaccgc gatcaccgca       720
     ctgggaatcg cggcgggcgg catggaaccg ctgcgcctgt tcctgcaaaa cgccggcgcg       780
     ctgcgttcgc tgatcatcga gcatggcgtg ccgttctggt tcgcgtcgcc gacgccgttc       840
     gcggcgtttc ggcttgccgg cctgtcgccc gccctcgcgt acgccggcca ggccgtcatc       900
     gcggcgatcg cgctcgcggc ggcgtgcttc gtctggcgcc gcagccggga cgcacggttg       960
     cgcggtgcgg tactggtcgt cgcgacgctg gccgccaatc cgtatgtctg gcactacgaa      1020
     ctgtcgtggc tgtgcatccc gatcgcgtgc atgatcgcca tcggcgcgca gtacggctgg      1080
     cggcgcggcg agcagtgcgt cgtcgccgtc atgtgggcgc tgccgatgta cgagtttctg      1140
     aatccgtggc tgacgctgcc gcagatcggg cctgccgtca cgacgaccgc gctgctcgtg      1200
     ctcctgcagc gcgcccgcac cctcccgcga tcccccgcgc ggcgataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page