(data stored in ACNUC1104 zone)

EMBL: CP000959.PE314

CP000959.PE314       Location/Qualifiers
FT   CDS_pept        374420..375487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3502"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bur:Bcep18194_B2061 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92655"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B1K2L0"
FT                   /protein_id="ACA92655.1"
FT                   /translation="MLPLRLLRSLLIASLFALPAAAAHADKPATIRIGVAQQGAGDPPT
FT                   FGGSSAATVQLQQLVEKEFAADGIKVEWLFFKGAGPAVNEAIANKALDFAYQGDLPAVL
FT                   ARSNGIKTRLLLAASVRSGIKIAVPPDSTIRSIKDLKDRRVSIFRGTNLQLVADNALAK
FT                   NGLGERDLRVINLDAASSLAALASKGIDASVGDYALYKLRDAGLAKIIYESQNDGPQLT
FT                   RQTHLLVLDDFDRAHPDIVQRVVTAFVKGAQWSSDEANRDALFKLWAKSGVPYSSWQAD
FT                   YANQRLKERLSPLIDPFVVARYKAVAQDALNLKLIRQPVDVDGWFEPKYLDNALRTLKL
FT                   ENYWPRYDAAGKPLT"
     atgctcccac tgcgcctgct gcgatcgctg ctgatcgcgt ccctttttgc gttgccggcc        60
     gccgccgcgc acgccgacaa gcccgccacc atccgcatcg gcgtcgccca gcaaggcgcc       120
     ggcgatcccc cgacgttcgg cggatcgagc gccgccaccg tgcagttgca gcagctcgtc       180
     gaaaaggaat tcgccgccga cggcatcaag gtggaatggt tgttcttcaa gggggcgggc       240
     ccggccgtca acgaggcgat cgccaacaag gcgctcgact tcgcgtacca gggcgacctg       300
     cccgccgtgc tcgcgcgctc gaacgggatc aagacccgcc tgctgctcgc cgcgagcgtg       360
     cgctcgggca tcaagatcgc ggtgccgccc gactcgacga tccgctcgat caaagacctg       420
     aaggaccgcc gcgtgtcgat cttccgcggc accaacctgc agctcgtcgc cgacaacgcg       480
     ctcgcgaaga acggcctcgg cgaacgcgac ctgcgcgtga tcaacctcga cgccgccagt       540
     tcgctcgccg cgctcgcatc gaaaggcatc gacgcgtcgg tgggcgatta cgcgctctac       600
     aagctgcgcg acgcgggcct cgcgaagatc atctacgaat cgcagaacga cggcccgcag       660
     ttgacgcgcc agacccacct gctcgtgctc gacgatttcg accgcgcgca cccggacatc       720
     gtgcagcgcg tcgtcaccgc gttcgtgaag ggcgcgcaat ggtcgtccga cgaggcgaac       780
     cgcgatgcgc tgttcaagct gtgggcgaag agcggcgtgc cgtattcgtc gtggcaggcc       840
     gactatgcga accagcgcct gaaggagcgc ctgtccccgc tgatcgaccc gttcgtcgtc       900
     gcgcgctaca aggccgtcgc ccaggatgcg ctgaacctca agctgatccg ccagccggtc       960
     gacgtcgacg gctggttcga gccgaagtat ctcgacaacg cattgcgcac gttgaagctc      1020
     gaaaactact ggccgcgtta cgacgccgcc ggcaagcccc tcacctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page